KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_2367Help
Entry
CMM_2367          CDS       T00529                                 

Gene name
ispE
Definition
(GenBank) putative 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
cmi00900  Terpenoid backbone biosynthesis
cmi01100  Metabolic pathways
cmi01110  Biosynthesis of secondary metabolites
cmi01130  Biosynthesis of antibiotics
Module
cmi_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CMM_2367 (ispE)
Enzymes [BR:cmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CMM_2367 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: CAN02442
UniProt: A5CTL3
Position
complement(2666044..2666982)
Genome map
AA seq 312 aa AA seqDB search
MTSAATTSDVVHARAPGKINVSLTVGALQEDGYHDVATAYQAVGLYEDVWATKADGFSVE
FGGSIDTSHLTTGADNLAVRAARLLARSTGYRGGVHLRIEKNVPIAGGMGGGSADAAATL
LACDTLWGTERTRDQLLALGAELGADVPFALAGGTAIGTGRGDRLSPALAKGTFQWVLAI
AEFGVSTPDVYGELDKHRERHAQDIFPAQQIPQVDSGVLQALRAGDPHMLAEVLHNDLQA
PALHLAPGLGEVLQLGEENGALAGIVSGSGPTVAFLAADLDSALELQIALSAARLTVIRA
TGPVHGARIITG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgacctccgcggccaccacctcagatgtggtgcacgcgcgggcccccggcaagatcaac
gtctcgctcacggtcggcgcactccaggaggacggctaccacgacgtcgccaccgcctac
caggccgtcggcctctacgaggacgtgtgggccacgaaggccgacgggttctcggtcgag
ttcggcggatccatcgacacgtcgcacctcaccaccggcgccgacaacctcgccgtgcgc
gcggcccggctcctcgcccggagcaccggctaccgcggcggcgtgcacctgcgcatcgag
aagaacgtccccatcgcgggcggcatgggcggcggatccgcggacgccgcggccaccctc
ctcgcctgcgacaccctgtggggcaccgagcgcacgcgcgaccagctgctcgcgctcggc
gcggagctcggcgccgacgtgccgttcgcgctcgccggcggcaccgccatcggcaccggt
cgtggcgaccgactcagccccgcgctcgccaagggcaccttccagtgggtgctcgccatc
gccgagttcggcgtctccacgcccgacgtctacggcgagctcgataagcaccgcgagcgc
cacgcgcaggacatcttcccggcgcagcagatcccgcaggtcgactcgggcgtgctgcag
gcgctgcgggcaggggatccgcacatgctcgccgaggtcctccacaacgacctgcaggcg
ccagcgctccacctcgcgcccggcctcggcgaggtgctgcagctcggcgaggagaacggc
gcgctcgcgggcatcgtctcgggatccggccccacggtcgcgttcctcgcggcggacctc
gacagtgcgctcgagctgcagatcgcgctgagcgcggcccgcctcacggtcatccgggcg
accgggcccgtgcacggcgcccgcatcatcacgggctga

DBGET integrated database retrieval system