KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_2446Help
Entry
CMM_2446          CDS       T00529                                 

Gene name
galU
Definition
(GenBank) putative UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
cmi00040  Pentose and glucuronate interconversions
cmi00052  Galactose metabolism
cmi00500  Starch and sucrose metabolism
cmi00520  Amino sugar and nucleotide sugar metabolism
cmi01100  Metabolic pathways
cmi01130  Biosynthesis of antibiotics
Module
cmi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CMM_2446 (galU)
   00052 Galactose metabolism
    CMM_2446 (galU)
   00500 Starch and sucrose metabolism
    CMM_2446 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CMM_2446 (galU)
Enzymes [BR:cmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CMM_2446 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: CAN02527
UniProt: A5CTU2
Position
complement(2757205..2758101)
Genome map
AA seq 298 aa AA seqDB search
MVTHITKAVIPAAGLGTRFLPATKAMPKEMLPVVDRPAIQYVVEEAVGAGLHDVLMITGR
NKTALENHFDRNAELEATLQLKGDDAKLRKVNESTDLADMHYVRQGDPKGLGHAVLRAEM
HVGREPFAVLLGDDIIDKRDVLLSRMIEVQLQRGCSVVALLEVDPSQTHLYGVATVEETD
DDDVVRITGMVEKPAAGTAPSNLAIIGRYVLRPEVFDVLHKTEPGKGGEIQLTDALEKMA
AAPEWTGGVYGVVFRGRRYDTGDRLDYLKAIVQLGVDHEDLGEGLREWLPEFVKTLER
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggtcacccacatcacgaaggctgtcatccccgccgcgggactcggaacgcgattcctt
cccgcgacgaaggcgatgccgaaggagatgctgccggtcgtggaccgcccggccatccag
tacgtggtggaggaggccgtgggcgccggactgcacgacgtcctcatgatcacgggccgc
aacaagaccgccctcgagaaccacttcgaccgcaacgccgagctcgaggccaccctccag
ctcaagggcgacgacgcgaagctccgcaaggtcaacgagtccacggacctcgccgacatg
cactacgtccgccagggcgaccccaagggcctcggccacgcggtgctccgcgccgagatg
cacgtgggccgcgagccgttcgccgtgctcctcggcgacgacatcatcgacaagcgcgac
gtgctcctgtcccgcatgatcgaggtccagctccagcgcggctgctccgtcgtcgcgctc
ctcgaggtggatccctcgcagacgcacctctacggcgtcgccacggtcgaggagaccgac
gacgacgacgtcgtgcgcatcaccggcatggtcgagaagcccgccgcaggcaccgcgccc
tccaacctcgcgatcatcggccgatacgtgctgcgccccgaggtattcgacgtgctgcac
aagacggagccaggcaagggcggcgagatccagctgacggatgcgctcgagaagatggcc
gccgcgcccgagtggacgggcggcgtgtacggcgtcgtcttccgcggccgccgctacgac
acgggtgaccggctcgactacctgaaggccatcgtccagctcggcgtcgaccacgaggac
ctcggcgagggcctgcgtgagtggctgcccgagttcgtcaagacgctcgagcgctga

DBGET integrated database retrieval system