KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_2495Help
Entry
CMM_2495          CDS       T00529                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CMM_2495 (gpmA)
   01230 Biosynthesis of amino acids
    CMM_2495 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CMM_2495 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CMM_2495 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CMM_2495 (gpmA)
Enzymes [BR:cmi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CMM_2495 (gpmA)
Exosome [BR:cmi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CMM_2495 (gpmA)
  Exosomal proteins of melanoma cells
   CMM_2495 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2810206..2810961)
Genome map
AA seq 251 aa AA seqDB search
MAEPRTLVLLRHGNSDWNQKNLFTGWVDVELSEQGVAEGQRAGELLAESGILPDVLHTSV
LIRAIDTANIALKRAGRSWIPVQRTWRLNERHYGALQGKDKAQTLAEYGPEQFATWRRSF
DVPPPPIDDDDEYSQSRDPRYADLGDALPRTECLKDVIERMLPYWESDIQPDLASGRTVL
VTAHGNSLRALVKHLDGISDADIAELNIPTGIPLVYRLDEDYRPIVPGGEYLDPEAAAAG
AAAVAAQGSKK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaccccgcaccctcgtgctgctgcgtcacggcaacagcgactggaaccagaag
aacctgttcaccggatgggtggacgtcgagctgagcgagcagggcgtcgcggaggggcag
cgcgccggcgagctcctcgccgagtccggcatcctccccgacgtgctgcacacctccgtc
ctcatccgcgccatcgacaccgccaacatcgcgctcaagcgcgccggccgctcgtggatc
cccgtccagcgcacctggcgtctcaacgagcgccactacggcgcgctgcagggcaaggac
aaggcgcagaccctcgccgagtacggccccgagcagttcgccacctggcgccgctccttc
gacgtgccgccgcctcccatcgacgacgacgacgagtactcgcagtcgcgcgacccccgc
tacgcggacctcggcgacgcgctgccccgcacggagtgcctcaaggacgtcatcgagcgg
atgctgccctactgggagtccgacatccagcccgacctcgcctcgggccgcaccgtgctc
gtcacggcgcacggcaactcgctgcgcgcgctcgtgaagcacctcgacggcatctccgac
gcggacatcgccgagctcaacatccccaccggcatccccctcgtctaccgcctcgacgag
gactaccgcccgatcgtccccggcggcgagtacctcgacccggaggcggccgccgccggg
gccgcggccgtggccgcgcagggcagcaagaagtag

DBGET integrated database retrieval system