KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_2700Help
Entry
CMM_2700          CDS       T00529                                 

Gene name
bgaB
Definition
putative beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CMM_2700 (bgaB)
Enzymes [BR:cmi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CMM_2700 (bgaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3032047..3033846
Genome map
AA seq 599 aa AA seqDB search
MPGLPASSTRFRIGTDDFELDGRPHRVIAGALHYFRVHPDQWADRIRKARLMGLDTIETY
VAWNAHSPERGAFDTSAGLDLGRFLDLVHAEGMHAIVRPGPYICAEWDGGGLPGWLFEDP
AVGVRRSEPLYLAAVDEFLRRVYEIVAPRQIDMGGPVILVQIENEYGAYGDDADYLRHLV
DLTRESGIIVPLTTVDQPTDEMLSRGSLDELHRTGSFGSRATERLATLRRHQPTGPLMCS
EFWDGWFDHWGEHHHTTSAADAAAELDALLAAGASVNIYMFHGGTNFGFTNGANHKGTYQ
SHVTSYDYDAPLDETGSPTAKFFAFRDVIARYRSVPDEVPAMRGDAPAFAIAFDAAVPLA
DLVPDDAAAWRATDAVPSMDQLGVFRGFALHRVELPASTRTRVLAFGEVRDRAVVSVDGV
RIGVIQRDQHETAIAVPPGRILEVLVEDQGRVNYGVRIGEAKGLIGPATLDGVELTGWAS
VPLDLDAMAGSVSSAASLAGASVAEPVRFLDGPVLAHASFDMDAPADLFLDTRSWGKGVA
FVNGFALGRHWTRGPQHTLYVPGAQLRAGRNDLVVFETGAAADPVVAFLAQPELGHLES
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcctccccgcctccagcacccgcttccgcatcggcaccgacgacttcgagctc
gacggccgcccgcaccgcgtcatcgcgggcgcgctccactacttccgcgtgcaccccgac
cagtgggccgaccggatccgcaaggcccgcctcatggggctcgacaccatcgagacgtac
gtcgcctggaacgcccactcgcccgagcgcggcgccttcgacacgagcgccggcctcgac
ctcggccgcttcctcgacctcgtgcacgcggagggcatgcacgcgatcgtgcgccccggc
ccctacatctgcgccgagtgggacggcggcgggctgccgggctggctgttcgaggatccc
gcggtgggcgtccgtcgcagcgagccgctgtacctcgcggccgtcgacgagttcctccgc
cgcgtctacgagatcgtcgcgccgcggcagatcgacatgggcggtcccgtgatcctcgtg
cagatcgagaacgagtacggcgcgtacggcgacgacgccgactacctccgccacctcgtc
gacctcacgcgcgagtccggcatcatcgtgcctctgacgaccgtcgaccagccgaccgac
gagatgctctcgcgcggcagcctcgacgagctgcaccgcaccggatccttcggctcgcgc
gccaccgagcgcctcgcgaccctccgccgccaccagccgaccgggccgctcatgtgcagc
gagttctgggacggctggttcgaccactggggcgagcaccaccacacgacctccgcggcc
gacgccgccgccgagctggacgcgctgctcgccgcgggcgcgtcggtcaacatctacatg
ttccacggcggcacgaacttcggcttcacgaacggcgccaaccacaagggcacgtaccag
tcgcacgtcacctcgtacgactacgacgccccgctggacgagaccggatccccgacggcc
aagttcttcgcgttccgcgacgtgatcgcgcgctaccggtccgtgcccgacgaggtgccg
gcgatgcgcggcgacgcgcccgcgttcgcgatcgcgttcgacgcggccgtgccgctggcc
gacctggtgccggacgatgccgctgcctggcgcgcgaccgacgccgtgccgtcgatggat
cagctcggcgtcttccgcgggttcgcgctgcaccgggtggagctgcccgcgtcgacccgc
acgcgcgtgctcgcgttcggcgaggtgcgcgaccgggccgtggtgtcggtcgacggcgtg
cggatcggcgtgatccagcgcgaccagcacgagaccgcgatcgccgtgccgcccggccgg
atcctcgaggtgctcgtggaggaccaggggcgcgtgaactacggcgtgcggatcggcgag
gcgaaggggctcatcgggccggcgacgctggacggcgtcgagctcaccggctgggcgagc
gtgccgctggacctggacgcgatggctggttcggtgtcgtccgctgcgtccttggctgga
gcctccgtcgcggagccggtccgcttcctcgacgggcccgtgctcgcgcacgcgtccttc
gacatggacgcgcccgccgacctcttcctcgacacgcgctcgtggggcaagggcgtcgcc
ttcgtcaacggcttcgcgctcggccgtcactggacccgcgggccgcagcacacgctctac
gtgccgggcgcgcagctccgcgcgggccgcaacgacctcgtcgtgttcgagacgggcgcg
gcggcggatccggtcgtggcgttcctggcgcagccggagctggggcacctggagtcgtga

DBGET integrated database retrieval system