KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_2942Help
Entry
CMM_2942          CDS       T00529                                 

Definition
(GenBank) putative 2-keto-acid dehydrogenase,dihydrolipoamide acetyltransferase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
cmi00010  Glycolysis / Gluconeogenesis
cmi00020  Citrate cycle (TCA cycle)
cmi00620  Pyruvate metabolism
cmi01100  Metabolic pathways
cmi01110  Biosynthesis of secondary metabolites
cmi01120  Microbial metabolism in diverse environments
cmi01130  Biosynthesis of antibiotics
cmi01200  Carbon metabolism
Module
cmi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CMM_2942
   00020 Citrate cycle (TCA cycle)
    CMM_2942
   00620 Pyruvate metabolism
    CMM_2942
Enzymes [BR:cmi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CMM_2942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: CAN03029
UniProt: A5CV90
Position
complement(3262136..3263536)
Genome map
AA seq 466 aa AA seqDB search
MADSEFTLPDVGEGLIDAEIVSWRVQPGDRVALNQVIVEIETAKSLVELPSPFEGTVSGL
LVQEGQTVEVGTPIIAIAQGSPSLSAPAETPAQMALPGETVIEDDTAIENREPAPAPAAE
ETSGAVLVGYGTVGKVASRRRRPELGDAAPAARRPASPSAPAGAPAARAPRPASVPAASA
VPIIAKPPIRKLAKDLEVDLAQVEATGLVGEITREDVIRTAQQASVFKNIETPEWPDARE
DRIPVKGVRKVIAAAMVQSAFQAPHVSLFVDVDATRTMEFVKRLKASTDFAGVKVSPLLI
MAKAMIWAVRRNPTVNSSWTDQEIIVRHYVNLGVAAATPRGLVVPNVKEAQAMSLLELAR
ALEQLTLTARDGKTSPADMSQGTITITNIGVFGMDTGTPILNPGEVAIVALGTIKQKPWV
VDGEVRPRFVTTIGASFDHRVVDGDVASRFLADVASIIEEPALLLE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggctgattccgagttcaccctgcccgacgtgggcgagggcctcatcgacgccgagatc
gtctcgtggcgcgtgcagccgggcgaccgggtggcgctcaaccaggtgatcgtcgagatc
gagaccgcgaagtcgctcgtcgagctgccgagcccgttcgagggcaccgtctccgggctg
ctcgtgcaggaggggcagacggtcgaggtgggcacgcccatcatcgcgatcgcgcaaggc
tcgccgagcctgtccgcgccggccgagaccccggcccagatggcgctgccgggcgagacc
gtgatcgaggacgacacggccatcgagaaccgcgagccggcccccgcgcccgcagccgag
gagacctcgggcgccgtgctcgtgggctacggcacggtcggcaaggtcgcgagccggcgc
cgtcgccccgagctgggtgacgccgcgcccgccgcccgccgccccgcgagcccgagcgcc
ccggccggagcgcccgccgcccgcgcgccgcggcccgcctcggtgcccgccgcctccgcg
gtgccgatcatcgccaagccccccatccgcaagctcgcgaaggacctcgaggtcgacctg
gcccaggtcgaggccaccgggctcgtcggcgagatcacgcgcgaggacgtcatccgcacc
gcgcagcaggcgagcgtcttcaagaacatcgagacgcccgagtggccggatgcgcgcgag
gaccggatccccgtgaagggcgtccgcaaggtcatcgccgcggccatggtgcagagcgcg
ttccaggcgccccacgtgagcctgttcgtcgacgtcgacgccacccgcacgatggagttc
gtcaagcgcctcaaggcgtccaccgacttcgcgggcgtcaaggtctcgccgctgctcatc
atggcgaaggcgatgatctgggccgtgcgccggaaccccaccgtgaactcctcgtggacc
gaccaggagatcatcgtccgccactacgtgaacctcggcgtggccgccgcgaccccgcgc
ggcctcgtggtgccgaacgtcaaggaggcgcaggcgatgtcgctcctggagctcgcccgc
gcgctcgagcagctcaccctcacggcgcgcgacggcaagacgagcccggcggacatgagc
cagggcaccatcacgatcaccaacatcggcgtcttcggcatggacaccggcacgccgatc
ctcaaccccggcgaggtcgcgatcgtcgcgctcggcacgatcaagcagaagccgtgggtc
gtcgacggcgaggtgcgcccgcgcttcgtcacgaccatcggcgcgagcttcgaccaccgc
gtcgtcgacggcgacgtggcgagccgattcctggccgacgtggcgagcatcatcgaggag
ccggcgctgctcctggagtga

DBGET integrated database retrieval system