KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_2953Help
Entry
CMM_2953          CDS       T00529                                 

Gene name
ppgK2
Definition
putative polyphosphate glucokinase (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:cmi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cmi00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cmi00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3272339..3273223
Genome map
AA seq 294 aa AA seqDB search
MPQPETAPRPASESGRATGGFIPVDRAVVAAPEGAAEALLRRDRLALGIDIGGTTLKAGI
VDVTTGIRLTERMTVAKPVGGEPEDIADVIAEIVLELTPDEDLPVGVGVPGIVRDGIVRS
SAHISDRWLGMDARTAIRERSGIDVLTVNDADAAGVAELEYGVLQGRGGLVILTTLGTGI
GTALLHDGTLIPNSELGHVHIDGGDYEMQAAFSAVRREGLTFEAWAARLERYYRHLESIM
SPDLIVVGGAAAHEFARFSAFLHLDTEIIAASRGNDAGLVGAALLAHRAGVAPD
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
gtgccccagcccgagaccgcgccgcggcccgcctccgagagcggccgggcgaccggcggg
ttcatccccgtcgaccgtgccgtcgtcgccgcccccgagggcgccgcggaggctctcctc
cgacgcgatcggctggccctcggcatcgacatcggcggcacgacgctcaaggccgggatc
gtcgacgtgaccacggggatccggctcaccgagcgcatgaccgtggcgaagcccgtcggc
ggtgagcccgaggacatcgcggacgtgatcgccgagatcgtgctggagctgacgcccgac
gaggacctgcccgtgggcgtcggcgtgcccggcatcgtgcgagacggcatcgtgcgctcc
tccgcgcacatctccgaccgctggctcggcatggacgcgcgcaccgcgatccgcgagcgc
agcgggatcgacgtcctcaccgtcaacgacgccgacgcagccggggtggcggagctcgag
tacggcgtgctgcagggccgcggcgggctggtgatcctcacgacgctcggcaccggcatc
ggcacggcgctgctgcacgacggcacgctcatcccgaacagcgagctcggccacgtccac
atcgacggcggcgactacgagatgcaggccgcgttctccgccgtccggcgcgaggggctg
acgttcgaggcgtgggcggcgcgactggagcggtactaccggcacctcgagtcgatcatg
tcgcccgacctcatcgtggtcggcggcgcggccgcgcacgagttcgcgcgcttctcagcg
ttcctgcacctcgacaccgagatcatcgcggccagccggggcaacgacgccgggctggtc
ggcgccgcgctgctcgcgcaccgggcgggcgtcgcgcccgactga

DBGET integrated database retrieval system