KEGG   Clavibacter michiganensis subsp. michiganensis: pCM1_0020Help
Entry
pCM1_0020         CDS       T00529                                 

Gene name
celA
Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cmi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
pCM1:17651..19891
Genome map
AA seq 746 aa AA seqDB search
MRKASVEVVFSAAGWLPYDPYMTFRQVRASLVLRLVLLLALVVGTTSAAFAAPVSAATVA
GPVAAASSPGWLHTAGGKIVTASGAPYTIRGIAWFGMETSSCAPHGLDTITLAGGMQHIK
QMGFTTVRLPFSNQCLAASGVTGVSADPSLAGLTPLQVMDHVVASAKSAGLDVILDQHRP
DSGGQSELWYTSQYPESRWISDWRMLAKRYAAEPTVIGVDLHNEPHGAATWGTGAATTDW
RAAAERGGNAVLAENPNLLVLVEGIDHEADGSGTWWGGALGLVGNAPVRLSVANRVVYSP
HDYPSTIYGQSWFSASNYPANLPGIWDAHWGYLAKKDIAPVLVGEFGTKFETTSDKQWLN
TLVGYLSSTGISSSFWAFNPNSGDTGGIVKSDWVTPEQAKLDALAPILHPSPGSGPGSGG
SGSQPAPQPDPANPGAVSAKWQPGSSWASGYVANIDVTATAAVTGWTVSWASPGTTRVVN
SWGMRCSVASGTVSCTGTDWASKLAAGQTVHVGLQASGGPAPSSPRLTATAAAVPPAQPT
PPARPTTHGRATHYSLGQGNTIANGNCSMPAVPADRMYVAVSSPEYSGAAACGTFLDVTG
PKGTVRVQVADQCHGCEVGHLDLSEEAFRALGDFNAGIIPISYVTVRDPAGPTVAIRVKE
GSSRWWAGLQVLNAGNRIDRVEIQAGRQWLPLTRTDYGYWVTPSPIQDGPLTVKVTDQYG
RAVVLPGLRMAPGEIQRTASRFYPVH
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaaggcgtctgtggaagtggttttcagtgcggccggatggcttccctacgatcct
tatatgacatttcgccaagttcgtgcatccttagtgcttcggctcgtccttctccttgcg
ttggtggtcggcaccacgtccgccgcattcgctgcgcctgtctcagccgccaccgtagcg
gggcccgttgcggcggcctcatcgcctggatggctgcatacggcgggcgggaagatcgtc
accgcctccggtgctccgtacacgatccgtggcatcgcttggtttggcatggagacgtcg
tcgtgcgcgccgcatggcctggacaccatcaccctcgcgggcggtatgcagcacatcaag
cagatggggttcacgaccgtgcggttgcccttctcgaaccagtgcctcgccgcgtccggc
gtcacgggtgtcagtgcggacccgtcactcgccgggctcacgccgctgcaggtcatggac
cacgtcgtcgcgtcggcgaagagcgccggtcttgacgtgatcctcgaccagcaccggccg
gactcgggcggccagtctgagctctggtacacatcgcagtatccggagtcgcggtggatc
tccgactggaggatgctcgcaaagcgctatgcagccgaacccaccgtcatcggtgtagac
ctccacaacgaaccgcacggtgcggcgacctggggtaccggggcggccaccactgactgg
cgggcagcggccgagcgtggcgggaatgcggtcctcgccgagaacccgaacctcctcgtg
ctcgtggagggcatcgaccacgaggccgacggatctggcacctggtggggcggcgcgctc
gggttggtaggcaatgcacctgtgcggctgtcggtcgcgaatcgcgtcgtctactccccg
catgactacccctcgaccatttacggccagtcatggttctccgcatcaaactatccggcg
aacttgccgggtatttgggacgcccactggggatacctggcgaagaaggacattgccccg
gttctcgtgggtgagttcggtacgaagttcgagacgacgagcgacaagcagtggctcaac
accctcgttggatatctgtcgagcacggggatcagctcgtcgttctgggccttcaacccg
aatagtggcgacaccggcggtatcgtgaagtccgactgggtgaccccggagcaggcgaag
ctcgacgccctggcgccgatcttgcacccgtcgcccgggtcgggtccgggatccggcgga
tccgggtctcagccagcgccgcagcccgatccggcgaacccgggcgctgtatcagcgaag
tggcagcctggcagctcctgggcatcgggctacgtagcgaacatcgacgtcaccgcgaca
gccgctgtcacgggatggaccgtctcatgggccagccccggaaccacccgcgtcgtcaac
agttggggcatgcgctgcagcgtcgcctccggcaccgtgagctgcaccggcacggactgg
gcgagcaagctcgccgccggccagaccgttcacgtcggcctacaggcgtcgggtggcccg
gctccctcttcaccacgactcaccgctacagcggccgcggtgccgcctgcccagcccaca
ccgcccgctcggcccacgacgcatggccgtgccacgcactactcgctcggccagggcaac
acgatcgcgaacggcaactgctccatgccggctgtccctgcagaccgaatgtacgttgcg
gtcagcagccccgagtacagcggtgccgccgcgtgcggcaccttcctcgacgtcactggc
cccaagggcaccgtccgcgttcaggtcgctgaccagtgccatgggtgcgaggtcggacat
ctcgatctgagcgaggaagcgttccgcgccctcggcgacttcaatgccggcatcatcccg
atcagctacgtcaccgtccgggatccggccgggcctaccgtcgccatccgagtcaaagaa
ggctcatcccgctggtgggcaggtctgcaggtcctgaacgccggcaaccgcattgaccgt
gtcgaaatccaggccgggagacagtggctgcccctcactcgcaccgactacgggtactgg
gtgacgccgtccccgattcaggacggccccctgaccgtgaaggtgaccgaccagtatggt
cgcgcggtcgtgctccccggcctccgcatggcacccggggagatccagcgcacggcctcc
cgcttctaccctgtgcactga

DBGET integrated database retrieval system