KEGG   Callorhinchus milii (elephant shark): 103173086Help
Entry
103173086         CDS       T03088                                 

Gene name
lyz
Definition
lysozyme (EC:3.2.1.17)
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
cmk  Callorhinchus milii (elephant shark)
Brite
Enzymes [BR:cmk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     103173086 (lyz)
Exosome [BR:cmk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103173086 (lyz)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 149 aa AA seqDB search
MKTLFVLSLLFLVASAKIYDRCVLARQLKAAGLDGFRGYSLPNWICMVQHESSYNTRAIN
ENRRQGRVVSTDYGLFQINSRYWCDDERTPGTSNTCRINCSAFLNDDITDDIRCVKRVVS
DPNGMAAWYGWRDHCRGRNLQSYVQGCNV
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaagactctctttgtcctgagcctcctgttccttgtcgccagtgccaaaatctacgat
cgatgtgttcttgccaggcagctgaaggctgcaggactggatggattcagaggttactct
ctccccaactggatttgcatggttcaacatgagagcagttacaacactcgggctataaat
gagaacaggagacaaggacgagtggtgtcgacagactacggcttgtttcagatcaatagc
cgttactggtgcgatgatgaacggacacctggtacttcaaacacctgcagaatcaactgt
tcagcctttttgaatgacgacatcacggatgatattcgatgtgtaaagagggttgtgagt
gatcccaacggcatggcagcttggtacggctggagagatcactgcagagggaggaacctc
cagagctatgtgcagggctgcaatgtctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system