KEGG   Callorhinchus milii (elephant shark): 103173148Help
Entry
103173148         CDS       T03088                                 

Definition
PC3-like endoprotease variant B
Orthology
K01359  
proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
cmk  Callorhinchus milii (elephant shark)
Brite
Enzymes [BR:cmk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     103173148
Peptidases [BR:cmk01002]
 Serine Peptidases
  Family S8: subtilisin family
   103173148
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 282 aa AA seqDB search
QRHITGSGVVVTVVDDGIDHKNTDLKGNYDPQASFDFNDHFDTLHDPIPNSSDKLNGHGT
KCAGEVAMQANNSFCGVGIAFNARIGGIRILDGKVTDALEAAALSYNNNYIDIYTCCWGP
NDNGMVFDGPRNLTTKALKEGAEKGRGGKGNIFIWASGNGGLANDHCGTDGYVNNIYTVA
VGAVSNLGLSPFYSEACAAVMAVVPTGGSSAYSYSFLEDENSLVTTELDGKCTNTFKGTS
SAAPMAAAVIALVLQAKAAIVLILDLIHHYIVKKDPAASGLT
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
cagagacacataactggctcgggtgtagttgtgacagtcgtagatgatggcattgaccac
aaaaacactgacttgaagggaaactatgacccccaagccagctttgatttcaatgaccat
tttgacacattacatgatccaattcctaattcttcagacaaattgaatggacatggaacc
aaatgtgcaggagaagtagcgatgcaggctaacaacagtttctgtggagttggaatcgca
ttcaatgcaagaattggaggtattcggatcttggatggcaaagtgactgatgctttggaa
gctgcagctctctcctacaacaataactacatcgatatctacacctgctgctggggaccc
aatgacaatggaatggtgtttgatggacccagaaacctgacaaccaaagctctgaaggaa
ggtgcagaaaagggtcgcggtggcaaaggaaatatttttatctgggcctcaggaaatggc
gggctggctaatgatcactgtggcactgatggatatgtgaacaatatttatacagtggca
gtcggagctgtcagtaaccttggcctcagccctttctactcggaggcttgtgcagctgtt
atggctgtagttcctacaggagggtcaagtgcctattcatattctttcctagaagatgag
aactctttggtgacaactgaacttgatggtaaatgcaccaataccttcaaaggtacttcg
agtgccgctccaatggcagctgctgttattgcattggtccttcaggccaaagctgcaata
gtccttattctggatttaattcatcattacattgtcaagaaagatccagcagcttctgga
ttgacttga

DBGET integrated database retrieval system