KEGG   Callorhinchus milii (elephant shark): 103176666Help
Entry
103176666         CDS       T03088                                 

Gene name
mgll
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:cmk00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    103176666 (mgll)
Enzymes [BR:cmk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103176666 (mgll)
Peptidases [BR:cmk01002]
 Serine Peptidases
  Family S33
   103176666 (mgll)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 332 aa AA seqDB search
MRTSDRVSLCFSLLLLLLLLPSNPSEKEGQLGGLGGEMPSEECADRVTPQGSLYRELPHI
INTDGQYLFCRYWSPKTKPRALVMIMHGAGEHSGRYNELAELIMNESIFVFAHDHVGHGQ
SEGNRMVISNFQVYIRDCLQHIDHMKEKYPGLNIFLIGHSMGGAIAILTANERPNDFAGV
MLIAPLITLQPETSTPTKVFLARLLNYVLPNIGLGSIDPNFISRSEEEVKNYINDPLNYH
GSVKVSFAVQLLNTVARIEEILPKITWPFLLLHGEADKLCDINGSYHMYDTAPSKDRTLK
VYTSAYHVLHKELPQVTSEVFTEIQKWIVKRL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaggacctccgatcgcgtctctctttgtttttctcttcttcttcttcttcttcttctt
ccttctaaccccagtgagaaagaagggcaactcgggggactggggggggagatgccatcg
gaggagtgcgcggatcgggtcaccccacaaggatcactgtacagggaactgccccacatc
atcaacaccgatggacagtacctgttctgcaggtactggagcccgaaaacaaagcccagg
gcgctagtaatgataatgcatggtgctggagagcacagtggccgctacaatgaacttgct
gaactgattatgaacgaatccatctttgtatttgcacatgaccacgttggccatggacag
agtgaagggaatcggatggttatttccaattttcaagtatacatacgtgactgcttgcaa
cacattgaccacatgaaggaaaagtacccaggtctaaacatttttctaatcggccattct
atgggtggagcaatcgccatcctcacagcgaacgagagaccaaatgattttgcaggggtg
atgttaatagcacctctgattaccctgcagcctgaaacatcaactcccaccaaggtgttc
cttgccaggctcctgaactatgttttgccaaatatcggtcttggatccattgatcccaat
ttcatatccagatcagaggaagaggtgaagaactatatcaatgatcctctgaactaccat
ggaagtgtaaaggttagctttgcagttcaactgttgaacacagttgccaggattgaagag
attctgcccaagatcacctggccattcttgctgctccatggtgaagcagacaaactgtgt
gacatcaacggctcttaccacatgtacgacacagcaccaagcaaagacaggactttaaag
gtctacacatctgcctatcatgtgctccataaagagttgccccaagtcaccagtgaagtg
ttcacagaaattcagaagtggattgtcaagaggttataa

DBGET integrated database retrieval system