KEGG   Callorhinchus milii (elephant shark): 103178713Help
Entry
103178713         CDS       T03088                                 

Gene name
eef2k
Definition
eukaryotic elongation factor-2 kinase
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
cmk  Callorhinchus milii (elephant shark)
Brite
Enzymes [BR:cmk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     103178713 (eef2k)
Protein kinases [BR:cmk01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   103178713 (eef2k)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 756 aa AA seqDB search
MAEDELIFNIEGVGLSETKRGFENDSDDEEQYLICPITDYDVSKNKPSEGRKICNRNFMK
NDLYGSSSSPGKHSFSFKNLQTPANCGSLTDQGRDAWKHAIEKAKQMPDPWAKFHLEEIE
AEPATRHRYNAISGKWVEDNVFVKMANQPFGRGAMRECYRTKKPSNFTRHQHWKSASNYV
AKRYIEAVERDVYFEDVRLQMEAKLWGEEYNRHKPPKQVDIMQMCILEMRDRPGKPLYHL
EHYIEGKYIKYNSNSGFVRDENFRLTPQAFSHFTFERSAHQLIVVDIQGVGDLYTDPQIH
TFSGTDFGDGNLGVRGMALFFHSHACNTICEKMGLMHFDLATKEKSALEHAQNLLKTAKT
VLRGTEEVCGSSRVRTTSGSRPPLLKRLSETSADECMSDSIFDSLPCSPLSLSFKEDFLG
KSPMGWTMFNQFDNLGDDSPNERRASENGCDSGCSSEKRSESEVDHLDRMNLHNRRSFES
DEDSIHQSKASPSVHKPLIDHRQNPQTQLDLLCEDKWNYYHSSRAHMHRPSCVAVEVQRL
NAISQEKKIGKSILGKVHLAMVRYHEAGRFCNKEEEWDRESGLFHLEHAALCGELEAIVA
LGLTYLQLPHHILPDVTAEDTENNRKKGFDSLVIAAEAGDRPSMILVARAFDTGLYLGPD
RTQDWKEALHWYNAALNMTDYDEGGEYDGTGDEPKYHLLAREAEMYMMGGFSVEPDPQRS
GDLFTEAAEAAMEAMKGRLATQYYERAEEAWGMMEE
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggacgaattgatcttcaatattgaaggggttggattgagcgagaccaagcgg
ggcttcgaaaacgatagtgatgatgaggagcagtacctcatctgccctattacagattac
gatgtcagcaaaaacaagccgagtgagggcagaaaaatatgcaaccggaattttatgaag
aatgacctctacggatcatccagctccccgggaaagcattcctttagttttaagaatctc
cagacacctgctaactgtggctcattaactgaccaaggtcgggatgcttggaaacatgca
attgaaaaagcgaaacaaatgcctgatccttgggcaaagttccatctggaggaaatcgag
gctgagcctgcgactcgtcacaggtacaatgccatttcaggaaaatgggtggaagataac
gtctttgtcaaaatggcaaatcagccctttggccgtggcgcaatgagggaatgttatcga
acgaaaaaaccttccaactttacccgccatcagcactggaaatctgcctctaattacgtt
gcaaagcgttacattgaggctgtggaacgggatgtgtattttgaagacgtgcgacttcag
atggaagcaaagctttggggggaagagtacaacaggcacaagccaccaaaacaggttgac
atcatgcagatgtgtattctggagatgagagaccgaccaggaaagcctctttatcacttg
gagcattacatagaggggaaatacatcaaatacaactcaaattcaggcttcgtaagagat
gaaaacttccgcttaaccccgcaggcatttagtcacttcacctttgaacgctctgcacat
cagctgattgttgttgacatccaaggtgtgggagacttgtacacagacccccaaatccac
acattcagtggcactgactttggagatggcaacctgggtgttcgaggaatggctctgttt
tttcattctcacgcctgtaacaccatctgtgagaagatgggactcatgcactttgacctg
gccacaaaggaaaagtcagccctagaacacgcacagaatctgctgaaaacagcaaaaact
gttctccgtggcaccgaggaagtgtgcggcagctccagagtgagaaccacctccggttcc
agaccgccccttctgaaacgactttccgaaacctctgctgatgaatgcatgagtgacagc
atatttgactctctgccttgctccccattatctttgagcttcaaggaagatttcttgggg
aaatctccaatgggatggacgatgtttaatcaatttgataacctgggagatgattcaccg
aatgagagaagggcatctgaaaatggttgtgacagcggatgctcgagtgagaagaggagt
gagtcagaagtggaccatctggacaggatgaatttgcataacagaagatcatttgagtct
gatgaggacagtattcaccagagtaaagcgagtccaagtgtgcacaaacctttaatcgac
cacagacaaaaccctcagacgcagctggatttactttgtgaagataaatggaattactat
catagttccagggctcacatgcaccgaccttcatgtgtggccgtcgaggtacaaagactt
aatgccattagccaggagaagaagataggaaagtctatactgggcaaggtccacctggct
atggtacgttatcacgaagccggtcgcttctgcaacaaggaggaagagtgggatcgcgag
tctggtctcttccatctcgaacacgctgccctatgcggggagctggaagcaatcgttgcc
cttggtctcacttatcttcagttacctcatcacatcctgcccgacgtcactgcagaggat
acagagaacaacaggaagaaaggttttgacagcttagtaatagcggcagaagcgggagat
cgaccttccatgattttagtcgcgagggcctttgatactggcttgtatctagggcctgac
aggacccaggactggaaagaagctctgcattggtacaatgctgctctgaacatgacggat
tacgacgagggcggagaatatgacgggacaggcgatgaaccaaaatatcatctgcttgcc
cgagaagcagaaatgtacatgatgggaggttttagtgtggagccagacccacagagatct
ggagatctcttcacggaagcagcggaagcagcgatggaggccatgaagggaagactggct
actcagtactatgagagagcagaggaagcctggggaatgatggaggaatga

DBGET integrated database retrieval system