KEGG   Callorhinchus milii (elephant shark): 103179052Help
Entry
103179052         CDS       T03088                                 

Definition
NADH-cytochrome b5 reductase 3-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:cmk00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    103179052
Enzymes [BR:cmk01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     103179052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 305 aa AA seqDB search
MGYSLTSGVILAVGAILVTTVGIVVGHFVINRKKKPLITLIDPNEKYLLRLIDKEVVSHD
TRRFRFALPSPKHILGLPIGKHVYLSAKIDGNLVVRPYTPVTSDDNKGYVDLVVKVYFKG
VHPKFPEGGKMSQYLEDLSIGDVIHFRGPSGLLLYEGKGNFAIQPEKKSPPELKFVRNLG
MIAGGTGITPMLQLIRAIMKDQDDPTLCYLLFANQTEKDILLRDELEELQAQHPDRFKLW
YTVDKAPEGWDFSEGFVNSDMMKENLPAPGDNTLVLMCGPPPMIQFACSPNLDKLGYPQG
MRYTY
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggggtactcactgacctctggagtgattcttgctgttggtgcaattcttgtaaccact
gtaggaattgttgtgggacattttgtgatcaataggaagaagaagcctctcatcacattg
attgatcccaatgagaagtatctgctgcgactcatagataaggaggttgtgagtcatgac
accaggcggtttcgttttgctcttccttcaccaaaacacatccttggcttgcctattgga
aaacatgtgtatctctctgcaaaaatcgatgggaaccttgtggtgagaccctacactccg
gttactagcgatgacaacaaaggttatgtggatcttgtggtcaaggtctattttaaaggt
gtccatcccaagttcccagaaggtgggaagatgtctcaatacctagaagatttgagtatt
ggtgacgtcattcatttcagaggacctagtggattgcttctgtatgagggaaaaggtaac
tttgccatccagcctgagaaaaagtctccaccagaactcaagtttgtcaggaaccttggc
atgattgccggtggaactggcatcactccaatgctgcagctgatccgggcaattatgaag
gatcaggatgacccgacactctgctatttactgtttgcaaatcaaactgaaaaagacatt
ctgctccgtgatgaattggaggaactccaggctcagcatcccgatcgtttcaagctgtgg
tacactgtggataaagcccctgaaggctgggatttcagtgaaggttttgtgaactctgac
atgatgaaggagaacctgcctgcccctggagacaacacactggtcctcatgtgtggccca
cctcccatgatccagttcgcctgcagccccaacctggacaagctcggctatccacaggga
atgcgctatacctactaa

DBGET integrated database retrieval system