KEGG   Callorhinchus milii (elephant shark): 103181381Help
Entry
103181381         CDS       T03088                                 

Gene name
alpl
Definition
alkaline phosphatase, liver/bone/kidney
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    103181381 (alpl)
Enzymes [BR:cmk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     103181381 (alpl)
Exosome [BR:cmk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103181381 (alpl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 546 aa AA seqDB search
MIASVNKVGTKTGFPGVTMKITALLLIAYVDLVFGYIPEEEKDPMYWRNQAQNVLKQALK
LQTLNTAIAKNIILFLGDGMGVPTVTAARILKGQLANRTGEEGFLEMDKYPHVALSKTYN
TNAQVPDSAGTATAYLCGVKANEGTVGVSAAALRKQCNTTFGNEVTSILKWAKDSGKSTG
IVTTTRVQHATPSAAYAHSVNRDWYADCDMPQEARDQGCKDIAQQLILNIRHIEVIMGGG
RKYMFPKGTPDEEYPTEGKANGTRLDGKNLVQEWKDSKQGKRAEYIWNKQQLKQLNLSKV
DYLMALFEHGDMQYELDRNQETDPSLEEMVEVALTILSRNPNGFFLLVEGGRIDHGHHEG
KAKKALFEVVEFDKAIGKAGVLTSARDTLSVVTADHSHVFTFGGYTNRGNNIFGLAPFLS
DIDHKPFTSILYGNGPGYKLASGERRNLSSVDINAKSYLAQSAVPLKQETHGGEDVAIFA
KGPMAHLFHGVHEQNYIAHVMAYAACIGQNKEHCSSSTWPRPSAAPSTAVASASLLLPLL
LLLLLS
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgattgcatcagtgaacaaagttggaacgaagacaggattcccaggagttacaatgaag
atcacagcgttgcttcttattgcttatgtggatcttgtctttggctacatcccagaggaa
gaaaaggacccaatgtactggaggaaccaagctcagaatgtactgaaacaagctcttaaa
ctgcaaaccctaaacacagctattgctaaaaatatcattctgttcctgggggatggtatg
ggggtgcccactgtcaccgcagctcgcattctgaaggggcaattggccaatcgcactgga
gaggagggcttcctagagatggataaatacccacatgtggctctttcaaagacgtacaac
acgaacgcccaggtgccggacagcgctgggactgccacagcgtacctgtgtggtgtgaag
gcaaatgaggggacggtgggtgtgagcgcggctgccttgcgcaagcagtgcaacaccacc
ttcggcaacgaggtcacctccatcctcaaatgggcaaaagattctgggaaatccactggc
atcgtaacaactacgcgggtccaacacgcgacccccagtgcggcctacgctcactctgtc
aatcgtgactggtacgcagactgcgacatgccacaggaggctcgtgatcagggctgtaag
gacattgctcagcaactcatcctcaacattcgccacatcgaggtgatcatggggggaggc
aggaagtacatgttcccgaaaggtacccccgacgaagaatacccgaccgaggggaaggcc
aatgggactcgattggatggaaagaacctggtgcaggagtggaaagacagtaaacagggc
aagagagctgagtacatctggaacaagcagcagctcaagcagctgaacttatccaaagtg
gattatttaatggctctgtttgaacacggggacatgcagtatgagctggacagaaaccag
gaaacggacccgtccctggaggaaatggtggaagtggcgctcaccatcctgtccagaaac
cccaacggtttcttcctgctggtggaaggtggacggatcgatcacggacaccacgaaggc
aaagccaagaaagctttatttgaagtggtggaatttgacaaggcgatcggcaaggccggg
gttttgaccagtgcgagggacacgctgtccgtggttacggctgaccactctcatgtcttc
accttcgggggctacactaaccgaggcaacaacatttttggtctcgctccatttctaagt
gacatcgaccacaagccgtttacttccatcctgtacgggaacggacctggctacaagcta
gccagcggggagcgacgcaacctgtcgagtgttgatatcaatgccaagagctatctggcc
cagtcggctgtgcccctgaagcaggagactcatggaggggaagatgtggccatatttgcc
aaaggcccaatggctcacctgttccacggggtgcacgagcagaactacattgcccacgtc
atggcctacgccgcttgtattggtcagaacaaggagcactgcagctcctcaacctggccc
aggcctagtgctgctcccagcactgcagtggccagcgccagcttattactgccattgctg
ctgttactgctgctgtcctga

DBGET integrated database retrieval system