KEGG   Callorhinchus milii (elephant shark): 103183194Help
Entry
103183194         CDS       T03088                                 

Gene name
srd5a1
Definition
(RefSeq) steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1) (EC:1.3.99.5)
  KO
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:cmk00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    103183194 (srd5a1)
Enzymes [BR:cmk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     103183194 (srd5a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 272 aa AA seqDB search
MCCCCCLSAPGFLGPAGGDGELLLLRRLSWLMILTGAAAFLLLQFVDLPYGRFASRKFGF
PVHVKLAWCVQEAPAMVLPLYLGLCSAGSASSLQRPNLVLLSMFTIHYIHRAFMFPFLIR
GGKATPFIPFILAFTFCVYNGYLQGRYLSRFAIYPADWITDPRFLTGLAVWLSGLLLNVT
SDHILRNLRKPGETGYKIPRGGMFEYVTGANFLGEIVEWTGFAIACWSLPSAAFAVFTFM
VLISRASQHHRWYLEKFEDYPTSRKALIPFLY
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtgctgctgctgctgcctgtccgccccgggcttcctgggcccggcgggcggggacggt
gagctgctgctgctgcggcgcctgtcgtggctcatgatcctcacgggcgctgcggctttc
ctgctcctgcagttcgtcgacttgccctacggccggttcgcctccaggaagttcggcttc
ccggtccacgtgaagctcgcctggtgcgtgcaggaggccccggccatggtcctgccgctc
tacctggggctctgcagcgcgggcagcgcttcctccctgcagcggcccaacctggtgctc
ctgagcatgttcaccatccactacatccacagggcatttatgttcccctttttaattaga
ggaggaaaggcaacaccttttattccatttatattggcgttcacattttgcgtttataat
ggatatctgcagggcagatacctaagcaggtttgctatttacccagcagattggataact
gacccacgtttcctcacaggtttggcagtgtggctttctggattgttactcaatgttact
tctgaccacatcctcagaaacttgcgtaaacctggagaaacaggatataagatcccaagg
ggaggaatgtttgaatacgtaactggtgctaattttcttggagagatcgtggaatggaca
ggatttgccatagcttgctggtcgctgccaagtgcagcgtttgctgtgtttacatttatg
gttcttatttctcgtgcttcgcaacatcacaggtggtatctggaaaagtttgaagattac
ccaacatcaagaaaggctttaataccattcctgtattga

DBGET integrated database retrieval system