KEGG   Carnobacterium maltaromaticum: BN424_1015Help
Entry
BN424_1015        CDS       T02342                                 

Definition
calcineurin-like phosphoesterase family protein (EC:3.1.3.16)
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1069172..1070554
Genome map
AA seq 460 aa AA seqDB search
MERVHIYHTNDLHSHFENWPRIEAYLAQQQKAHQEQKENVFTFDIGDACDRVHPLTEATD
GQANIQLLNEGHYDAVTVGNNEGIGNSKKQLNQLYTKANFDVVLANLADIRTGEAPDWAL
PFKIYETKDGFRFGVFGLTAPFPTSYVPNGWQVSEPDSIIPEILELLTPLVDAVILLSHL
GIMEDRRIAEMYPMIDLIIGSHTHHLLPDGETVRQTLITAAGKFGMYVGHIELEIDDFKR
LTVTKASVIETARLPVASHETERIKEYEIKGHRLLKTQKVAYLPNDLPVDWFASSPLVEM
GLKAVKDYAKTEVSILNAGLFMKGLTAGLVSKDDLHTLLPHPMRVMRCTLSGGDIARMIL
EMEKNRGYLKSFPIKGMGFRGKLFGEICYDGIEYDATNRSIKWLGEPLDEYREYTFATVD
HFLYIPYFPTIEICGVNEVIFPYFIRNVFGQYLTRNYPIE
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggaacgagttcatatttatcatacaaatgatttacattcacactttgagaattggcct
cgaattgaagcttacttagctcagcaacaaaaagctcatcaagaacagaaggagaatgtt
tttacatttgatattggtgatgcttgcgatcgagtacaccctctaactgaagctaccgat
ggtcaagctaatattcaattattgaatgaagggcactatgatgctgttactgttggaaat
aatgaaggcatcggaaattctaaaaaacaattaaatcaattatacacaaaggctaatttt
gatgttgttttagctaatttagcggatatcagaacaggagaagcgccggattgggcgttg
ccttttaaaatttatgaaacaaaagatggatttcggtttggagtttttggtttaacagca
ccgtttccgacaagctatgtaccaaatggatggcaggttagtgaaccagatagtattatc
ccagaaatattggaacttctgactcctttagttgatgcagtgattctgttatctcatttg
gggattatggaagatcgtcgtattgctgaaatgtatccaatgattgatttaattattggc
tcacatacccaccatctattgccagatggagaaactgtacgacaaacattgattacagct
gctggtaagtttggaatgtatgttggacatattgaacttgaaatcgatgactttaaacga
ttaactgttactaaagctagtgtaattgagactgcaaggttacctgttgccagtcatgaa
acagaacgtatcaaagagtatgagataaagggacatcgtttattaaaaactcaaaaagtt
gcttatttgcctaatgatttgccagttgattggtttgcttcatcgccacttgtcgaaatg
gggttaaaagccgtaaaagattatgctaaaactgaagtgtcgattttaaatgcaggtttg
tttatgaaaggattgactgcagggcttgtttcgaaagatgatttgcacaccttgttacct
catccaatgcgcgtaatgcgctgtaccctttctgggggggacattgccagaatgattctt
gaaatggaaaaaaatcgaggttatctaaaaagttttccaattaaagggatgggattccga
ggaaaactatttggagaaatttgttacgatggcattgaatacgatgctacgaataggagt
atcaaatggttgggagagcctcttgatgagtatagggagtatacatttgcgacagttgat
catttcttatatatcccttactttccaaccatcgaaatttgtggcgtcaatgaagtgatc
tttccttattttattcgaaatgtcttcggacaatatttaacaaggaactatccaattgag
taa

DBGET integrated database retrieval system