KEGG   Carnobacterium maltaromaticum: BN424_1106Help
Entry
BN424_1106        CDS       T02342                                 

Definition
dockerin type 1
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1149788..1151683)
Genome map
AA seq 631 aa AA seqDB search
MKKKTIKLMLVLSLLVTLASCGTATNSSTSTSKSSSSTETTSTSTNIATTTTDDNGLFGT
YTAEDQDSNWDETSGTTIQLNKTSIKVDGSGASATDSIVTITAAGTYIVSGTLTDGQIKV
NASKEDTVRIILNGVDITSSTTSPIYVQQADKMILTLADKTENKVSDATEYSYPDATTDE
PDAAIFSKDDLTINGSGALNISGNYNNGIASKDDLVITDGTITVDAKNHALRGKDSVSIL
AGTFVLKAGNDGIQTNNSEDTTKGWIGIDGGTYTITAAHDGIQAESSLLISNGNFTIKTG
AGSDSQTSVTTNTSTTAENSNSFKALKATEQLTIQDGSFTLNAEDDALHTNGIITINGGE
FSISTGDDGMHADDTLTINAGTIDIKKSYEGLEAAFIVIKDGTIHVTSSDDGINAAGGSD
GTTDEIGPGGQKDNFSSGGDYGLTITGGRIVVDAGGDGLDSNGDIDMSGGVVLVNGPTDN
GNGAIDFDGTFNLNGGTLVASGSSGMAETPSTSSTQASLNLIFSNTQQAGTLVHIEDENG
DEVLTFAPTKNFQSIVISTPDMLQGSKYTLYSGGSHSGTTTDGLYQNGSYTIGTQLTTAT
LTDVSTSISETGASITTGGMGGGGGRPPGNN
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaagacaattaaattaatgctagtactctcgttactagtgactttagcaagt
tgtggtacagcgacgaattcgtctacctctacctcaaaatcatctagttcaacggaaact
acttctacttctacaaatatagccacgacaacaacagatgataatggcctatttggaacc
tacacagcagaagatcaggacagtaactgggatgaaacgagtggaacgactatccaatta
aacaaaacttctattaaagtagacggttctggagcttctgctacagatagcattgttaca
attacagcagctggaacttatatcgtttctggtacattaacagacgggcaaattaaggtt
aatgccagtaaagaagatactgtgagaattattctaaatggagttgatatcactagttca
acaacatctcctatttatgttcaacaagctgataaaatgattctgaccttagctgataaa
actgaaaataaagttagtgatgcaactgaatatagttacccagatgcaacgacagacgaa
cctgatgctgcaatttttagtaaagatgatttaacaattaacggttctggagctttaaac
atttccggaaattataataatggcattgcaagtaaagatgacctagttattacggatggg
acgattacagttgatgctaaaaatcatgctctgcgcggaaaagactccgtttctatttta
gctggaacatttgtgcttaaagctggcaatgatggaattcaaaccaataattcagaggat
acaacgaaaggttggatcggaattgatggtgggacctatacaatcacagcagctcatgat
ggcattcaagccgaaagttcccttttaatttctaatgggaattttactattaaaacaggt
gctggaagtgatagtcaaacttccgtaactacgaatacaagcacaactgcagaaaattct
aacagctttaaagcgctcaaagcaactgaacaattaaccattcaagatggctcatttaca
cttaatgccgaagatgatgctcttcatactaatggcattattacaatcaatggtggtgaa
ttttctatttcgactggtgatgatggcatgcatgcagatgatactttaacaataaatgct
ggaacgattgatataaaaaaatcttatgaaggtcttgaagcagccttcattgtaattaaa
gatggaacgattcatgttactagttcagatgatggaattaatgcagctggtggtagtgat
ggaacaactgatgagattggaccaggaggacaaaaagacaatttcagttctggtggtgat
tacggtttaactattacaggtggccgaatcgtagttgatgcaggcggagacggtttagac
tcaaatggggacattgatatgagtggcggagttgttttagtcaatggtccaacagataat
ggaaatggtgcgatagattttgatggaacctttaatttaaatggcgggaccctagttgca
tctggtagctcaggtatggctgaaacaccgagtacatcttccactcaagcctctttaaat
ttaattttttctaacacacaacaagccggaacattagttcacatcgaagatgaaaatggg
gatgaagtcctaacctttgctccaactaagaatttccaatccattgttatcagtactcct
gatatgctacaaggtagtaaatacacattatactctggtggtagccattccggaacaact
accgatggattatatcaaaatggttcttacacaattggaacacagctgacaactgcaaca
cttactgatgtcagcacaagtatttcagaaacaggtgctagtatcactactggcggtatg
ggaggcggcggtggacgccctcctggaaataattaa

DBGET integrated database retrieval system