KEGG   Carnobacterium maltaromaticum: BN424_1184Help
Entry
BN424_1184        CDS       T02342                                 

Gene name
rpmF
Definition
(RefSeq) ribosomal protein L32
  KO
K02911  
large subunit ribosomal protein L32
Organism
cml  Carnobacterium maltaromaticum
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:cml00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    BN424_1184 (rpmF)
Ribosome [BR:cml03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    BN424_1184 (rpmF)
  Bacteria
    BN424_1184 (rpmF)
Mitochondrial biogenesis [BR:cml03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BN424_1184 (rpmF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1235721..1235900
Genome map
AA seq 59 aa AA seqDB search
MAVPARRTSKAKKNRRRTHYKLEVPGMNPCPNCGELKKSHHVCPACGQYDGKEVISKEA
NT seq 180 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaccagctagaagaacatcaaaagcgaaaaaaaatagacgtcgtacgcattat
aaattggaagttccaggcatgaacccatgtcctaactgtggcgaactgaaaaagagccac
cacgtatgtccagcatgtggacaatatgacggtaaagaagtaataagtaaagaagcttaa

DBGET integrated database retrieval system