KEGG   Carnobacterium maltaromaticum: BN424_1184Help
Entry
BN424_1184        CDS       T02342                                 

Gene name
rpmF
Definition
ribosomal protein L32
Orthology
K02911  
large subunit ribosomal protein L32
Organism
cml  Carnobacterium maltaromaticum
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:cml00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    BN424_1184 (rpmF)
Ribosome [BR:cml03011]
 Ribosomal Proteins
  Mitochondria
   Large subunit
    BN424_1184 (rpmF)
  Bacteria
    BN424_1184 (rpmF)
Mitochondrial biogenesis [BR:cml03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BN424_1184 (rpmF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1235721..1235900
Genome map
AA seq 59 aa AA seqDB search
MAVPARRTSKAKKNRRRTHYKLEVPGMNPCPNCGELKKSHHVCPACGQYDGKEVISKEA
NT seq 180 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaccagctagaagaacatcaaaagcgaaaaaaaatagacgtcgtacgcattat
aaattggaagttccaggcatgaacccatgtcctaactgtggcgaactgaaaaagagccac
cacgtatgtccagcatgtggacaatatgacggtaaagaagtaataagtaaagaagcttaa

DBGET integrated database retrieval system