KEGG   Carnobacterium maltaromaticum: BN424_137Help
Entry
BN424_137         CDS       T02342                                 

Gene name
yloB
Definition
calcium-transporting ATPase (EC:3.6.3.8)
Orthology
K01537  
Ca2+-transporting ATPase [EC:3.6.3.8]
Organism
cml  Carnobacterium maltaromaticum
Brite
Enzymes [BR:cml01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.8  Ca2+-transporting ATPase
     BN424_137 (yloB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
152961..155726
Genome map
AA seq 921 aa AA seqDB search
MKYYTKEKHEVLKEFDVTIESGLTDASSAANREKFGENKLKEEKADPYWRIFLRSFKEPI
VIVLMGAIVLSFFSAYYDLQIKGDIKHGTEAIYEGTAILILILINATLSFWQEISAKKSL
DALKQLSNRKVSVMRNGNWGHYDSVDLVPGDIVKVNVGDFIEADIRWLETSELQIIESHL
TGEADAIQKQIDALEGDVGVGDQTNMGFSGSTVSNGSGIGIVVATGQQTELGKIAELLQN
VESKPSPLQMTVGKLTRSLMLISGVVVVFTLVVGLFQSYQATGVLTFSAVGSVLSTAIAL
AVASIPDALPAVLSIVLTIGASRMAKNKGLIKSLSSVETLGATSYVCSDKTGTLTKNEMT
VIKFFANGTIYSVSGKGYGPEGEITSTDSNAPSYHDFVKGAVLCNEAEVKFIDGKYKPFG
NPTEVALTILGEKAQLKKESLLEQGIEIYRVLPFTSSRKMMSVIVKENNEYKLYTKGAPD
ILIEKSRFTLQNGNLVDTSDVKELLDTTTLSFANEALRTLAVAEKVISKEEAETGSVEEL
ETGFTMTGIAGIIDPPRDEVRASVELLKEASVKVVMITGDHEATAKAIAYDLKIIDSVDA
PSIKGAEIEKMSDEELFQRVKDTQVYARVSPEHKQRIVEQLQKHGEIVAMTGDGVNDAPA
LRAADIGIAMGIAGTEVTKDSADLILLDDKFTTIEKTVESGRTIYANIKNFIRHELTTNV
AEVLSLLIGLLFFTTGIGQVSASTPTLTALMILWVNMVSDAIPSFSLGYDVAESDIMNEK
PRDPKESVLANYTWSRVLIRGTVMGLTVFLAFVWAAKSGLSGNQAQTVAFLTLVYGQLWH
VFDARSSKTLFRRNPFQNKHLIAAVLFAGISSYLVTIIPFFNTVMGTAPLSLNIYLLVLF
VPAIPTLVLSGLKEIFGIKIW
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgaagtattatacaaaggaaaaacacgaggtgttgaaagaatttgatgtcacgattgag
tcaggtttaactgatgcatcaagtgcagcaaatagagaaaaatttggcgagaataaactt
aaagaagaaaaagcagatccgtattggagaatttttcttcgtagttttaaggagccaatc
gtcattgtattaatgggtgcgattgtcttatctttttttagtgcttactatgatttgcaa
attaagggcgatatcaaacatggaactgaagctatctatgaaggtacagcgattctaatt
ttgattttaattaatgcaacactctctttttggcaagaaatcagtgctaaaaaaagttta
gatgctctaaaacaactatctaatcgaaaagtgtctgttatgcgcaatggaaattgggga
cattatgattcggtggatctagttccaggagacattgtgaaagtcaatgtcggcgatttt
attgaagcagatatccgttggttagagacgtcagaactgcaaatcattgaatcgcattta
actggcgaagcagatgctatccaaaaacaaattgacgctttagaaggtgacgttggagtt
ggagatcaaaccaatatgggcttttcaggttcaactgtctcaaatggtagtggaattggg
attgttgtggcaacaggacaacaaacagagttaggtaaaattgcggagttgcttcaaaat
gttgagtcaaaaccttcgcctttgcaaatgacggttggaaaattaaccagatcattgatg
cttatttcaggtgtagtggttgtctttacgttagtggttggtttgttccaatcctaccaa
gcaaccggagtcttaactttttcggctgtcggtagtgtcttatcaacggcaattgcttta
gcggtagcttcaataccagatgctttgccagctgttttatctattgtattaacaattgga
gctagcagaatggctaaaaataaaggcttaatcaaatccctaagcagtgttgaaacatta
ggtgcaacatcatatgtatgttcagataaaacaggaacattaacaaaaaatgaaatgaca
gtcatcaaatttttcgcaaatggtacaatttattctgtttctggtaaaggctatggacca
gagggcgaaattacaagtacagattcaaatgcaccaagttatcatgattttgttaaaggt
gcggtattgtgtaatgaagctgaagtgaagtttattgatgggaaatataaaccgtttggt
aatccaacagaagtagcattgactattttaggtgaaaaagcccaacttaagaaagaatct
ttacttgagcaaggaattgaaatctaccgtgtattgccttttacaagtagtcgtaagatg
atgagtgtcattgtaaaagaaaataatgagtataaattatatacaaaaggtgctccagat
attttaattgaaaaaagtcgctttacgttacaaaatggcaatcttgttgacacgagtgat
gtaaaagaacttttagatacaacaacattatcttttgctaacgaagcattgcgtacgttg
gcagtagcagaaaaagtgatttcaaaagaagaagctgaaacaggttctgtagaagaactt
gaaactggatttaccatgacgggaattgcagggatcattgatccgccaagagacgaagtt
agagcttcagttgaattgttgaaagaagcctctgtcaaagttgtgatgattactggagat
catgaagcaacagcgaaggcaattgcttatgatttaaagattattgattcagtggatgca
ccatcaatcaaaggtgcggaaatcgaaaaaatgtctgatgaagagttgttccaacgtgtg
aaagatacacaagtttatgcgcgtgtttcaccagagcacaaacaaagaattgttgaacaa
ttacaaaagcatggtgaaattgttgctatgactggtgatggtgtcaacgatgctccggct
ttaagagcagcagatatcgggatagcaatgggaattgctggaactgaagtgacaaaagat
tcagctgatttaattttattagatgataagtttacgactattgaaaaaactgttgagagc
ggtcgaacgatttatgcgaatataaaaaactttattcgtcatgagttaacaaccaatgtt
gctgaagttctttctttattaattggtttactattctttacaactggtatcggacaagtt
tcagcttcaacaccaacgttgacagccttaatgattctttgggtcaatatggtaagtgat
gccatcccatcattttcattaggatatgatgtagctgagtcggatattatgaatgagaaa
ccacgcgatccaaaggaatctgttttggcaaattatacgtggtcacgtgtattaattcgt
ggaacggtcatgggtttaacagtctttttagcctttgtttgggcagcgaaaagtggctta
tcaggtaaccaagcacaaacagtggctttcttaacactggtatatggccaattatggcat
gtatttgatgcacgtagttcaaaaacactatttagaagaaatccgtttcaaaataagcat
ttgatagctgcagtcttatttgcggggattagttcttatttagtgacgattatcccattc
tttaatacagtgatgggaacagcacctttatcgttaaacatttatttactcgtattattt
gttcctgcgattccaaccttagttttatcaggcttaaaagaaatttttggcataaaaatc
tggtag

DBGET integrated database retrieval system