KEGG   Carnobacterium maltaromaticum: BN424_1390Help
Entry
BN424_1390        CDS       T02342                                 

Definition
lmo2051 protein
Orthology
K07177  
PDZ domain-containing protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1431073..1431993
Genome map
AA seq 306 aa AA seqDB search
MNELISVDNQKDKEDGSFMLTTVGVRQATAFTYFMRFLPFHEGLTKKELYGDVSSNKEFN
QVQDYYMTSSVNAAIELAYRTAGAEYKTHYKGVYVMSILDESKFKGKLEVGDTIVSLDGH
SFKSSEEFIDYVKSKKVGEEIDVVVNRNGSEKKVSAPLMKMDTDKKAGLGISLVNDTTIT
TTIPVDVNTEEIGGPSAGLMFSLEIYTQLKGINLRDGRQIAGTGTISPDGTVGRIGGIDK
KVVAADKEGATIFFAPDDEIDPAIKKKYPELKTNYEEAKAAAKKIGTKMKIVPVKTFQDA
VDYLEK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
ttgaatgaacttatcagcgttgataatcaaaaagataaagaagatggtagttttatgtta
acgactgttggtgttcggcaagcaacagcctttacctattttatgcgctttttacccttt
catgaaggactaactaaaaaagaactttatggtgatgtcagctcaaataaggagttcaat
caagtacaagactattatatgacaagttcggtgaacgctgctattgagctagcttatcga
acagcaggcgctgaatataaaacacattataaaggtgtttatgtgatgtcgattctggat
gaatcaaaattcaaagggaaattagaagttggggatacaattgtttctctagatgggcac
tcattcaaaagttcagaagagtttattgactatgtaaaatctaaaaaagttggggaagaa
attgatgtagttgtcaatcggaatgggtcagaaaaaaaagtttcggctccattaatgaaa
atggatacggataaaaaagccggattaggaattagtttggtaaatgacacaacgatcaca
actacaattcctgttgatgtaaatacagaagaaattggtgggccgtctgctgggttaatg
tttagtttagagatttatactcaattaaaaggaattaatttacgagatggacgtcaaatt
gctggtacagggacgatttcaccagatggaacggttggacgaattggtggaattgataaa
aaagtggtagcagcagataaagaaggagcgactattttctttgcaccagatgatgagatt
gatccggctattaaaaagaaatatccggaattaaaaacgaattatgaagaagctaaagca
gctgcaaaaaaaattggtacgaaaatgaaaattgtccctgtaaaaactttccaagatgca
gtggattatttagaaaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system