KEGG   Carnobacterium maltaromaticum: BN424_1437Help
Entry
BN424_1437        CDS       T02342                                 

Definition
ROK family protein (EC:2.7.1.-)
Organism
cml  Carnobacterium maltaromaticum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1480657..1481604
Genome map
AA seq 315 aa AA seqDB search
MERTHEKYYLSLDVGGTFIKHALIDKSGHIICLAKVTTPINLADFLETIKQIVQSYLPTI
RAVCFSCPGKIDTKSGTVYFGGALLYLDKFSIKTYIETEFSIPCTITNDGKAAALAELWR
GQLEGIANGGVITLGTGVGGGLVINGNLLEGTNFQAGEISYMLMSRDSPIALSEIAGSMG
SAVRFIEEASNLLQLPTSNGVIVFKELQKNNALIQPLFEEYCRNITIIISNIQTVVDLER
VAIGGGISEQPLLIEEIRRQYRLMRETSKGILEMLHPISIVACEFRNEAGLMGALYHLLI
QIEEKQLDYWTIIVD
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaacacatgagaaatactatctaagtttggatgttgggggcacgtttatcaaa
catgcattaattgataaaagtggacatattatttgtttagcaaaagtaacaacaccaatt
aatctggctgattttcttgaaacaattaagcaaattgttcagtcttatttgccgactatt
agggcggtttgctttagctgtcctgggaaaatcgatacgaaatcagggactgtttatttt
ggtggagcgttactttatttagataagttctcgattaaaacttatattgaaactgaattt
tccattccttgtacgataactaatgatggtaaagctgcagcgctagcagagttatggcgt
gggcagctagaaggcattgcaaatggtggtgttataacattaggaactggagttggtggc
ggcttggtgattaatggaaatttacttgaaggtactaactttcaggctggtgaaataagt
tatatgttaatgtcaagggattcgccaattgcattatcggaaattgctggaagtatggga
tctgctgttcgtttcatcgaagaggcttcaaatttacttcagttacctacaagtaatggg
gtaattgtattcaaagaattgcaaaagaacaacgctttaattcaaccattgtttgaagag
tattgccgaaacattactattattatttcaaatattcaaactgtagtggatcttgagcgg
gttgctatcggcggaggaattagtgaacaaccgttgctgattgaagagatacgtagacaa
tatcgcttaatgcgtgaaacatcaaaggggatcttagaaatgctacacccaattagtatt
gtagcttgtgaatttcgaaatgaagcgggcttaatgggagcgttgtatcacttattgatt
caaattgaagaaaaacaattggactattggactatcatagttgactaa

DBGET integrated database retrieval system