KEGG   Carnobacterium maltaromaticum: BN424_1662Help
Entry
BN424_1662        CDS       T02342                                 

Definition
LD-carboxypeptidase family protein
Organism
cml  Carnobacterium maltaromaticum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1700445..1701359)
Genome map
AA seq 304 aa AA seqDB search
MLKKGDTIGIIACSNGKKLSQKKKIDELINLLATQFSLTVIEAATIYEKNEFPFSGTPSE
RAQALMQLYLNPSVVMIFDISGGNVANEILPYLDFKQIEKQRKLFVGYSDLTVILNALYT
KTTCSGINYQLLNLVGEEQTSQLAYFNDYFFHNKRQTSITAQWLSSSSPITNIIKGTLIG
GNIRCLLKLAGTDYLPNCQNKLLFLEANSGDIPAMATYLAQLDQIGYLQQCQAVILGQFT
EIEAQKQTTAFYKLVSSYLMNYQKPILMTHEIGHSASSKALSIGEIVYFDEDHGKLRMTL
ADDK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaaaaggagatacaatcggcattattgcttgctctaacggaaaaaaactaagt
caaaaaaagaagattgacgaactaattaacttattagcaacgcagttttctttgactgtt
attgaggctgctacaatttatgaaaaaaatgagttcccttttagtggaacaccctcggaa
agagctcaggcattaatgcagctttatctaaatccctctgttgtcatgatttttgatatt
tcaggagggaatgtagccaatgaaattttgccttatttggattttaaacagattgaaaag
cagcggaaattatttgttggatatagtgacttaactgtgattttaaatgcattatatact
aaaacaacatgtagcggaattaattatcaactccttaacttagttggagaagaacagact
tctcaattagcgtatttcaatgattatttttttcataataaaagacaaacatcaataacg
gcccaatggcttagttcttcgagtccaatcacaaatataataaaaggaaccctaatagga
gggaatattcgttgcttacttaaacttgctggaaccgactatttacctaattgtcaaaat
aaattactttttttagaagcaaacagtggggatatcccagctatggcaacttacctggct
caattggatcaaattggttatttgcaacaatgccaagctgtgatactaggtcagtttaca
gagattgaagcacaaaaacaaactacagctttttataaacttgtgtcttcttatttaatg
aattatcaaaaacctattctaatgacacatgaaattgggcatagtgcatcttcaaaagcc
ttatcgattggggaaattgtttattttgatgaagaccatggtaaattaagaatgactcta
gctgatgataaataa

DBGET integrated database retrieval system