KEGG   Carnobacterium maltaromaticum: BN424_1764Help
Entry
BN424_1764        CDS       T02342                                 

Gene name
cdd
Definition
cytidine deaminase (EC:3.5.4.5)
Orthology
K01489  
cytidine deaminase [EC:3.5.4.5]
Organism
cml  Carnobacterium maltaromaticum
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cml00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BN424_1764 (cdd)
Enzymes [BR:cml01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.5  cytidine deaminase
     BN424_1764 (cdd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1807623..1808036)
Genome map
AA seq 137 aa AA seqDB search
MTKQDVQKQLWIQKANEMLTKAYVPYSHFPVGAALVTTDGKIYSGCNIENASYGLSNCAE
RTAIFKAISEGEREFSYLVITGDTDGPIAPCGACRQVIAEFCPSTMPILLTNKKGDQMET
TIASLLPGAFTPEDLIT
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagcaagacgtccaaaaacaactttggattcaaaaagccaacgaaatgttaact
aaagcttatgttccatactcgcattttcctgtgggtgctgctttagtaacaacagatggt
aagatttattcaggatgtaatattgagaatgcttcctatggtttatcaaattgtgctgaa
cgtacagctatttttaaggcgatttcagagggcgaaagagagtttagttacttagtgatt
acaggcgatacagatggtcctattgcaccatgcggagcttgtcgacaagtaatagctgaa
ttttgtccgtctactatgccgatcttattaacaaataaaaagggtgaccaaatggaaacg
acgattgcaagtcttttacctggcgcttttacaccggaggatttaattacatga

DBGET integrated database retrieval system