KEGG   Carnobacterium maltaromaticum: BN424_1801Help
Entry
BN424_1801        CDS       T02342                                 

Gene name
cwp84
Definition
papain cysteine protease family protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1845136..1847688)
Genome map
AA seq 850 aa AA seqDB search
MKKIMIGLLTTGLFLCTWSLHVSADTLDTPELIEIHPLGIDGNKGSWNSDEPVIPQSKEI
VQSRGILPKKLDPRGTDFEQTVRSQGGIGICWAYSSTDIISAAYQKQTGIEQLLSPNYYN
YYSAENAFSDGFNPNTIFLQLAEKRTLNQGGFHQYPLFQNMLNNQGVTEKEFTTPTVEAK
NKPLLNDDFNMVKAKKSSLAMNELKHIPLNEYTISESEKEIKRTKIKRFIQESGAVTYNY
QSETVSHSKKYYNNGKAASYVPVADFNKIPNYSSQGRPAIDHSVTIVGWDDDYSKDNFSI
QPKQEGAFIVKNSWGTSFGDKGYFYVSYEDIFIATGEFYSAISSKSELYDNFNSYVNSTS
DAWEKIEASKNPSNEIYLAANYQTNTNEEILKTVAFLTIQNNIDYKIYYVNKKIESDYFD
SSIFTELIAEGTQIEAGMNNIPTKEVEIPADSNYGIVVQLIYPSELELQYFTAQKVKEGN
QQDNVPILEAGDTLVSYNGFRWRNTSKGEYWATKANLFLTAATDSVTSEENKIASVAITN
KIDPKIVYKNKPIVLDTTLAPEGAKKKDLLWSSKDSSIAEVDQSGTVTAKGFGRTVINVC
SKQNPEIKDQLTIITDDHGFSTETATKLTIGQPMEGYIDLADNEYISENPWYNRSDVFLY
TIPEDGNYTTHGYAITPTGTQDIFRSDFSINDGPYRLAIADRFFTEKLKKGDIVEISATA
QCLGFNNPLGDWAKTTVGSKYYIEFKKSDEFKFGKLVWASSEGTSKENLKTMFKVGEKEQ
FVGTIVDSNINDPFYQKLKWKSSNPSVAKINEETGELEALSVGTTTLILNNTYYFGEAKQ
LEEQLMVTVE
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataatgattggtttacttacaactggattattcctttgtacatggagcttg
catgtctcagctgatacgttggacacaccagagcttattgagattcatccactaggaata
gatggaaataaagggtcttggaatagcgatgaacctgttattccacaatcaaaagaaata
gttcaatctagagggattttaccaaaaaaacttgatccacggggaactgattttgagcaa
actgtcagaagtcaaggtggtataggtatttgttgggcgtattcaagcacagatatcatc
tcagcagcatatcaaaaacaaactgggatagaacaacttttatcacccaattactataac
tattattcagcagaaaatgctttttcagatggatttaatccaaatactatatttttacag
ttggcggagaaaagaactttaaatcaaggaggatttcatcagtatcctctgtttcaaaat
atgttaaacaatcaaggtgttacagaaaaagagtttaccacacctactgtagaagcaaaa
aataaaccactattaaatgatgactttaatatggttaaagcaaaaaaatcatcattagca
atgaatgaacttaaacatattccacttaatgaatataccatttcggagtcggaaaaagaa
ataaagcgaacaaaaattaagcgatttattcaagaaagtggggcggttacctataattat
caatctgaaacggtttctcactcaaaaaaatattataataatgggaaagctgcaagttac
gttccggtggctgattttaacaaaattcctaattattcatctcaaggacggcctgctatc
gatcattcagtgacaattgtcggatgggacgatgattatagtaaagataatttttcaatt
caaccaaagcaagagggcgcctttatagtgaaaaattcatggggtacttcgtttggcgat
aaaggttatttttatgtaagttatgaggatatttttattgcaacaggtgagttttacagt
gcaataagttctaaatctgaattgtatgataattttaacagttatgttaattctactagt
gatgcgtgggagaaaatagaagcgtctaaaaatccatctaatgagatttatctagcagct
aattatcaaaccaatactaatgaagaaattctaaaaacagtagcttttttaactattcaa
aacaatattgattataagatttattatgtgaataaaaaaattgaatcagattactttgat
tctagcatatttacagaattaattgcagaaggaacacaaatagaagcgggaatgaataat
attcctacaaaagaagtggaaattccagccgactcaaattatggaatagttgttcaatta
atttatccttctgaattagagctgcaatactttactgcccaaaaggtgaaagaaggaaat
caacaagataacgtacctattttagaagctggggatacccttgttagttacaatggtttt
cgctggcgaaatacatctaaaggagaatactgggctacaaaggctaatttgtttttgact
gctgcgactgatagtgtaacaagtgaagaaaataaaatagcatccgtcgctattacaaat
aaaatagatcctaaaattgtttataaaaataaacctatcgtactagatacaacattagct
cctgaaggtgcaaaaaagaaagacttattgtggagcagcaaagattcatcaatagcagaa
gttgatcaatctggaacagttacagctaaagggtttggccgaactgtaattaacgtttgt
tcaaaacaaaatcctgaaatcaaagatcagttgactattattacagatgatcatggattt
tcaacagaaacagcaacaaaattaacaataggtcagccaatggaaggttatattgatttg
gcagataatgaatatatttctgaaaatccatggtacaacagaagtgatgtcttcctctat
acgattccagaagatggtaactatacaactcatggttatgcgataacgcccacaggcaca
caagatatttttagatcagatttttcaataaatgatggtccctatcgacttgccattgcg
gatcgttttttcactgaaaaactaaaaaaaggggatattgttgaaattagcgcaactgcc
caatgtttaggatttaataatccattaggtgattgggctaaaacgactgttggttccaaa
tattatattgaatttaagaaaagtgacgaatttaaatttgggaaattagtttgggctagt
tctgaaggcacctcaaaagaaaacctgaaaacgatgtttaaagtaggtgaaaaagaacaa
tttgttggaacgattgttgatagtaatattaatgatccattttatcaaaagttaaaatgg
aagagtagcaatccaagtgtggctaaaatcaatgaagaaactggagaattagaggcactt
tcagttggaacaacaaccttgattctaaataatacgtattactttggtgaagctaagcaa
ttagaggaacaactaatggttacagtggaatag

DBGET integrated database retrieval system