KEGG   Carnobacterium maltaromaticum: BN424_201Help
Entry
BN424_201         CDS       T02342                                 

Definition
LPXTG-motif cell wall anchor domain protein
Organism
cml  Carnobacterium maltaromaticum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
225646..226623
Genome map
AA seq 325 aa AA seqDB search
MKTIKHVLLWGVSLFCFFSFTVTSFANTATSQAGISFTEKEDMEAGNTSLPKNKDLPNTG
VDRTSSKLPQTGETADGNLLITGLVFLGAAIAVEKLRTKRGGRKMKLKTMTMLGLIGSGM
LLGASTSTAAPQDVVTGSEDGKGGTSHGYINLTPGDSDTGKTDPTDPTDPSGETGNEGIL
TIDHVVPLLFSSHKLEGKEQVYTSVVDKPNVQVTDKRGEEAGWNVQVSQTAFVDQTDATK
TLKGAKLVLPVGTLKDVGNVSLAPELYAVEVNDAPATFMNAKTGSGAGTWTNFFDKDEIK
LTVPAGNKKGEYMSTVTWTLMDAPK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaataaagcacgttctattgtggggggttagtttattttgttttttttctttt
acagtaacaagttttgccaatacagctactagtcaagcaggtatttcttttactgaaaaa
gaagatatggaagcaggaaatacttctcttccaaaaaataaagatttgcctaatacgggg
gtcgatagaacgagctcaaaattgccacaaacgggagaaactgcagatggaaatttactt
ataacagggttggtttttttaggagctgcaatagcagttgaaaaattaaggacaaaacga
ggaggaagaaaaatgaaattaaaaacaatgacaatgttaggtttgattgggagcggtatg
ttgctaggagcaagtacgtcaactgctgcaccacaagatgtggttacaggtagtgaagat
ggtaaaggcggtacatctcatggatacattaatttaactccaggagattcggacacagga
aagacagacccaacagacccaacagatccatcaggcgagactggaaatgaagggatttta
acgattgatcatgttgttccgttgctatttagctcacataagttagaagggaaagaacaa
gtttacacttctgttgtagataaacccaatgttcaagtaacggataagcgtggagaagaa
gcggggtggaatgttcaagtatctcaaacggcttttgtagaccaaactgatgcaactaaa
acattaaaaggcgcaaaattagtattgccagtaggtacattaaaagatgtaggaaatgtt
tcgctagcaccagaattgtatgcggtcgaagttaatgatgcgcctgctactttcatgaat
gcaaaaactggcagcggtgctggaacatggacaaacttttttgataaagatgaaatcaag
ctaactgttcctgctggaaacaaaaaaggcgaatatatgtcgacagttacatggacatta
atggatgcgcctaaataa

DBGET integrated database retrieval system