KEGG   Carnobacterium maltaromaticum: BN424_2026Help
Entry
BN424_2026        CDS       T02342                                 

Gene name
marR
Definition
marR family protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2045197..2045661)
Genome map
AA seq 154 aa AA seqDB search
MLPNSFETINDYLVDVFNEILTIEETALQNSSFEDVSIKEMHTVEAIGMYQRRTTSEVAK
KLQITVGTLTVAVNNLVRKGYVERIRSEDDRRVVKLGLTKRGRLLFRLHDKFHKEMVKET
IEDMQPEEIDILIKGLRNLHGFLDKTQKKLKEQG
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
gtgttgccaaactcatttgaaacgattaacgattatttagtcgatgtgtttaatgaaatt
ctgacaattgaagaaacagctttgcaaaatagtagttttgaagatgtttcaattaaagaa
atgcatacagttgaagcaatcggcatgtatcagagacgtacgacttcagaagtcgctaag
aaacttcaaattactgtgggtacattaactgttgcagtcaataatttagtccgaaagggc
tatgtagaaagaattcgaagcgaagatgatcgacgagttgtgaaattaggtttaaccaaa
cgtggtcgcttattatttcgactacacgataaatttcataaggaaatggtaaaagaaaca
attgaggatatgcaacctgaagagattgatattttaattaaaggtttgcgaaacttacat
ggtttcttagataaaacacaaaaaaaattgaaagaacagggctga

DBGET integrated database retrieval system