KEGG   Carnobacterium maltaromaticum: BN424_2026Help
Entry
BN424_2026        CDS       T02342                                 

Gene name
marR
Definition
(GenBank) marR family protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 HTH_24 HTH_34 TrmB HTH_41 HxlR HTH_20 GntR Fe_dep_repress Penicillinase_R
Motif
Other DBs
NCBI-ProteinID: CCO11467
UniProt: K8E4J6
Position
complement(2045197..2045661)
Genome map
AA seq 154 aa AA seqDB search
MLPNSFETINDYLVDVFNEILTIEETALQNSSFEDVSIKEMHTVEAIGMYQRRTTSEVAK
KLQITVGTLTVAVNNLVRKGYVERIRSEDDRRVVKLGLTKRGRLLFRLHDKFHKEMVKET
IEDMQPEEIDILIKGLRNLHGFLDKTQKKLKEQG
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
gtgttgccaaactcatttgaaacgattaacgattatttagtcgatgtgtttaatgaaatt
ctgacaattgaagaaacagctttgcaaaatagtagttttgaagatgtttcaattaaagaa
atgcatacagttgaagcaatcggcatgtatcagagacgtacgacttcagaagtcgctaag
aaacttcaaattactgtgggtacattaactgttgcagtcaataatttagtccgaaagggc
tatgtagaaagaattcgaagcgaagatgatcgacgagttgtgaaattaggtttaaccaaa
cgtggtcgcttattatttcgactacacgataaatttcataaggaaatggtaaaagaaaca
attgaggatatgcaacctgaagagattgatattttaattaaaggtttgcgaaacttacat
ggtttcttagataaaacacaaaaaaaattgaaagaacagggctga

DBGET integrated database retrieval system