KEGG   Carnobacterium maltaromaticum: BN424_2072Help
Entry
BN424_2072        CDS       T02342                                 

Gene name
aad2
Definition
iron-containing alcohol dehydrogenase family protein (EC:1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cml  Carnobacterium maltaromaticum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cml00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BN424_2072 (aad2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN424_2072 (aad2)
   00620 Pyruvate metabolism
    BN424_2072 (aad2)
   00650 Butanoate metabolism
    BN424_2072 (aad2)
  Lipid metabolism
   00071 Fatty acid degradation
    BN424_2072 (aad2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BN424_2072 (aad2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BN424_2072 (aad2)
   00626 Naphthalene degradation
    BN424_2072 (aad2)
Enzymes [BR:cml01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BN424_2072 (aad2)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BN424_2072 (aad2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2092302..2094851)
Genome map
AA seq 849 aa AA seqDB search
MIDTLAAKGQAALKVLETFDQEKIDYIVHQMAMAGLDQHMPLAKMAVEETGRGIYEDKCI
KNMFATESIWNSIKHNKTAGVISDDQQTQITEVATPVGVVCGVTPVTNPTSTTMFKAIIS
LKTRNPIIFAFHPSAQNCSAASAKVLYDAAIKAGAPEGCIQWVEKPSIEATNSLMNHPDI
AIVLATGGSAMVKSAYSTGKPALGVGPGNVPSYIEKTAKIKRAVNDVIASKSFDNGMICA
SEQAVIVDEEIYDEVKAEFVKHQVYVVKQKEIAQLEAVVMNEGKYAVNPAIVGKSAYEIA
KLAGIDVPERTKILIAEIAGAGEKYPLSREKLSPVLAMIKATSTEHAFELCDTMLELGGL
GHSAAIHTLNDNLAREFGIQMKACRILVNSPTAQGGIGDLYNNMIPSLTLGCGSYGKNSV
SKNVSTINLMNVKTIAKRRNNMQWFRLPSKIYFEKNSLQYLQKMENVERVFLVCDPGMVQ
FGYADLVIKELNKRNNAVQIEVFSQVEPNPSTNTVEKGTEAMLAFNPDTIVALGGGSAMD
AAKGMWLFFEKPETEFFGAKQKFLDIRKRTYKIPALTKTQFVCIPTTSGTGSEVTPFAVI
TDSETHVKYPLADYALTPDVAIIDPQFVMSVPKSVTADTGMDVLTHAIESYVSVMASDYT
RGLSLQAIKLVFENLKNSYELANEEAREKMHNASTMAGMAFANAFLGINHSIAHKIGGEY
NIPHGRTNAILLPHVIRYNAKDPSKHALFPKYEFFRADEDYADIARFMGFKGNTTAELVE
SLVQEIIKLGKSLNIDMSLKGQGVTQETLDTTVDNMAELAFMDQCTTANPKEPLISELRQ
IIIDSYIGE
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgattgatacgttagcagcaaaaggacaagcagcattaaaagtattagaaacatttgat
caagaaaagattgactacattgttcaccaaatggcgatggcaggattagaccaacatatg
ccacttgcaaaaatggctgttgaagaaactggccgtgggatttacgaagataagtgtatt
aaaaatatgtttgcaacagaatcaatctggaattcaattaaacataacaaaacagctggc
gtaattagtgatgatcaacaaacacaaattacagaagttgcaactccagttggtgttgtt
tgtggtgttacacctgtaacaaacccaacttcaacaacgatgtttaaagcaattatttca
cttaaaacacgtaatccaattattttcgctttccatccatcagctcaaaattgttctgca
gcatctgctaaagttttgtatgatgcagcaatcaaagcaggtgctcctgaaggctgtatc
caatgggttgaaaaaccttcaattgaagcaacaaattcactaatgaatcaccctgatatt
gcgattgttttagcaactggtggttcagcaatggttaaatcagcgtattcaactggaaaa
cccgctcttggagttggtcctggtaatgtaccaagttatattgaaaaaacagcaaaaatt
aaacgtgcagttaatgatgtcatcgcttctaaatcatttgataatggtatgatttgtgca
tcagaacaagcagtgattgtagatgaagaaatttatgatgaagttaaagcagaatttgtg
aaacatcaagtttatgttgtaaaacaaaaagaaattgctcaattagaagcagtggttatg
aatgaaggtaaatatgccgttaatccagcaattgttggtaaatcagcatacgaaattgct
aaattagcaggaattgatgttcctgaaagaacaaaaatattaatcgctgaaatcgctggg
gctggtgaaaaatatccattgtcacgtgaaaaattatctccagtattagcaatgattaaa
gctacttcaactgaacatgcttttgagctatgtgatacaatgcttgaattaggcggatta
ggtcactcagcagcgattcatacattaaacgataatttagcacgcgaatttggaattcaa
atgaaagcttgtcgtattttagtaaattcaccaacagcacaaggtggtatcggtgattta
tataataatatgattccttcattaacattaggttgtggttcatacggaaagaactcagtt
tctaaaaacgtatcaacaattaacttgatgaatgtcaaaacaatcgcgaaacggagaaat
aatatgcaatggttcagattaccttcaaaaatttactttgaaaaaaattctttacaatac
ttgcaaaaaatggaaaatgttgaacgtgtattcttagtttgtgatcctggaatggttcaa
tttggttatgcagatttagttattaaagagctaaataaacgtaataatgcggttcaaatc
gaagtcttttcacaagtagaaccaaacccatctacaaatacagttgaaaaaggtacagaa
gctatgttagctttcaatccagatacaattgtggctcttggtggtggttcagcaatggat
gctgctaaaggaatgtggttattctttgaaaaaccagagacagaattctttggagcaaaa
caaaaattcttagatattcgtaaacgtacgtataaaatccctgctttaacaaaaacacaa
tttgtttgtatcccaacaacatcaggaacaggatctgaagtaactccatttgctgttatt
actgatagtgaaacacatgttaaatatcctttagcagattacgcattaacaccagatgta
gcgattattgatcctcaatttgtcatgagtgtgccaaaatctgttactgctgatacagga
atggatgtactgacacatgcgattgaatcttatgtttcagtgatggcaagtgattatact
cgtggtttaagtttacaagcgattaaattagtatttgaaaacttgaaaaactcatatgaa
ttagcaaatgaagaagcaagagaaaaaatgcataatgcttcaacaatggctggtatggct
tttgctaacgcattcctaggaattaaccattcaatcgctcataaaattggtggagaatac
aatattcctcatggtcgtacaaacgcaattctattgccacatgttattcgttacaatgca
aaagatccttctaaacatgcattgttccctaaatatgaattcttccgtgcggatgaagac
tatgctgatatcgctcgcttcatgggattcaaaggaaatacaacagctgaattagttgaa
tctctagttcaagaaattatcaaattaggtaaatcattgaatattgatatgagcttgaaa
ggtcaaggtgtgacgcaagaaacactagatacaactgttgataacatggctgaattagcc
tttatggatcaatgtacaactgcaaatcctaaagaaccattaatcagtgaattgcgccaa
attattattgattcatatattggtgaataa

DBGET integrated database retrieval system