KEGG   Carnobacterium maltaromaticum: BN424_2153Help
Entry
BN424_2153        CDS       T02342                                 

Definition
ASCH domain protein
Organism
cml  Carnobacterium maltaromaticum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2169379..2169627)
Genome map
AA seq 82 aa AA seqDB search
MKVHELKIEPKYFEAVKDGRKKFEIRKNDRNFQEGDVLILKEYDPITQLFSGEAIEVEIS
YMPDFPLKDGYVVLGIEEVWEC
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtacacgaactcaaaattgaacctaaatatttcgaggcagtgaaggatggtaga
aagaagtttgagattagaaagaatgatcgtaactttcaagaaggagacgttttaatttta
aaagaatatgatccgattactcagttgttttcgggtgaagccatagaagttgaaatatcg
tatatgccagattttccgctgaaagatggctatgtagttcttgggattgaggaagtttgg
gagtgttag

DBGET integrated database retrieval system