KEGG   Carnobacterium maltaromaticum: BN424_2178Help
Entry
BN424_2178        CDS       T02342                                 

Definition
phage integrase family protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2182148..2183302
Genome map
AA seq 384 aa AA seqDB search
MAGGVRKRGEKWYYYYEAGSVAGKRKRIERVGGKTKKEAQDKLRKALNEYENAGIHVDES
GISFADYFNYWYKNYVMLNLKYKTQKGYIHIIEKHLIPEFGKYRLKSIKTSHLQTYLNSL
VTRGYSKNTIKGIYGVLSRGFKMAVYPFEYLKDSPMIYAELPKMPNNDLTKKKAKLKIIS
EKDYKRILERIPVSTPTHIPIQIAYHTGMRAGEVCGLTWDNVDLENKIIHVDKQLVLIDD
IKPTIGTPKTFSSIRDIEIGDTLVSILIKHKLRQESNKEFYGKYYYQEDYDFVCRRENGQ
VVTQNAFKHLSDIVNKELGIDFSFHSFRHTHATMLLEKGADAKDVQARLGHGDINTTMNT
YAHATKKMSRKTVDLFEKDLPSNN
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggctggtggagttagaaaacgtggagaaaaatggtactattattatgaagcaggctct
gttgctgggaaaagaaaaagaattgaacgtgttgggggtaaaacaaaaaaagaagcccaa
gacaaactaagaaaagctttaaatgaatatgaaaatgctggaatacatgttgatgaatca
ggaattagttttgctgattattttaattattggtacaagaactatgtaatgctgaactta
aaatataaaacccaaaaaggttacattcatattattgaaaagcacttgatccctgaattt
ggaaagtatcgtttgaaatctattaaaacaagccatctgcagacttatttaaactcgttg
gttactagaggatattcaaaaaatacaattaaaggaatttacggcgtattatctcgagga
ttcaaaatggcggtttacccttttgaataccttaaagacagcccgatgatttacgctgaa
cttccaaaaatgcctaataacgatcttactaagaaaaaagctaaacttaaaattatttct
gaaaaagattataagcgaatactagaaagaattccagtttctacccctacccacatacct
attcaaattgcataccacacaggaatgcgtgctggtgaagtttgtggtttaacatgggat
aatgttgatttagaaaataaaatcattcatgttgataagcagcttgttctaatagatgat
attaaacctacaatcggaacacctaaaacattcagctcgattagagatattgaaattggg
gatacattggttagtattttaattaaacataagttaagacaggaatctaataaagaattt
tacggaaaatactattatcaggaagattatgactttgtatgtcgacgtgaaaacggtcaa
gttgtaacacagaatgcctttaaacatctgtcagacatcgttaataaagaattaggtata
gacttctcttttcattcattcaggcacacacacgcaactatgctgctagaaaaaggtgct
gatgcaaaagatgtacaagctcgattaggtcatggtgatattaataccacaatgaacaca
tacgctcatgctactaaaaaaatgtccagaaaaacggttgatctattcgaaaaagattta
ccaagtaacaattga

DBGET integrated database retrieval system