KEGG   Carnobacterium maltaromaticum: BN424_2188Help
Entry
BN424_2188        CDS       T02342                                 

Definition
hypothetical protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2193173..2193286)
Genome map
AA seq 37 aa AA seqDB search
MFIIFFFIQLICYFWQFFDFYGLVLLYKSKMRYDGTK
NT seq 114 nt NT seq  +upstreamnt  +downstreamnt
ttgtttattattttcttttttatacaattaatttgttatttttggcaattttttgatttt
tatggcttagttcttttatataagagcaaaatgcggtatgatggtactaaataa

DBGET integrated database retrieval system