KEGG   Carnobacterium maltaromaticum: BN424_249Help
Entry
BN424_249         CDS       T02342                                 

Gene name
aroA
Definition
3-phosphoshikimate 1-carboxyvinyltransferase (EC:2.5.1.19)
Orthology
K00800  
3-phosphoshikimate 1-carboxyvinyltransferase [EC:2.5.1.19]
Organism
cml  Carnobacterium maltaromaticum
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cml01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cml00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
287106..288392
Genome map
AA seq 428 aa AA seqDB search
MKLVTNKNNLKGTIKVPGDKSMSHRSIMFGSIAEGTTRIKHFLRADDCMSTIAAFRALGV
EIEETPEEIIVYGKGWDALKAPTEAIDIGNSGTTIRLLMGILAGRDFESTLFGDESIAKR
PMNRVMLPLNQMGAHCVGSHETEFPPVTVRGTTSLHPISYQMPVSSAQVKSAILFAALQA
DGETTIIEKKKTRDHSEHMIRQFGGEIFVDDLTIKVKGKQKFTGQTMTVPGDISSAAFFI
VAGLIASNSQICLTNVGLNPTRTGIIDVVEQMGGKLTISDASRDTGKLAGTITVETSQLK
GVEIGGDLIPRLIDELPVIALLATQAEGITIIKDAAELKVKETNRIDAVVRELTTLGAKI
EATDDGMIIYGKTKLHGGKVTSYGDHRIGMMLQVAALIIDDGEVELEKAEAVSVSYPEFF
KDIVSLCN
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactagtaacgaataagaacaatttgaaagggacaataaaagttcctggcgacaaa
tcaatgtctcatcgcagcattatgtttggttcaattgcagaaggaacgacacggattaag
catttcttacgagcagatgactgtatgagtacgattgctgcttttagagcacttggtgtg
gaaatcgaagaaactccagaagaaattattgtttatggtaaaggttgggatgcattaaaa
gctccaaccgaagctattgacattggaaattcaggaacaacgattcgattactgatggga
attctagcggggcgggattttgaaagcacgctatttggagacgaatccatagcgaaacgt
ccgatgaatcgtgtcatgcttccattaaatcaaatgggtgctcattgtgttggtagtcat
gaaactgaatttccgccagtgactgttcggggcacaacgtctttacatccaatcagctat
caaatgccagtctctagtgcgcaagtgaaaagtgccattttatttgctgcgttacaagcc
gatggagaaacaaccattattgagaaaaagaaaacacgagatcattcagagcatatgatt
cgtcaatttggtggagagatttttgtagatgacttgacaattaaagttaaagggaagcaa
aaattcacagggcaaacgatgacagtacctggcgatatttcatccgcagcgttctttata
gttgccggtttaatcgcttctaatagccagatttgtttaacaaatgtgggcttaaatcca
actagaaccggaattatcgacgtcgttgagcaaatgggtggtaagttaaccattagcgat
gctagtcgtgatacagggaaactagcaggcacaatcacagttgaaactagccagttaaaa
ggtgttgaaattggtggagacttgattcctcgtttaattgatgaattacctgtaatagct
ttattagcgactcaagcagaaggcatcacgattattaaagatgcagctgaattaaaagtg
aaagaaaccaatcggattgatgcagtagttcgtgagttaaccacattaggggctaagata
gaagcgactgatgatggtatgattatctatggaaaaacaaaattacatggtgggaaagta
accagctatggtgatcatcgaatcggaatgatgcttcaagtagcggctttaattatagat
gatggtgaagttgaattggaaaaagctgaggctgtttctgtttcttatccggaattcttt
aaggatatcgtctcattgtgtaactaa

DBGET integrated database retrieval system