KEGG   Carnobacterium maltaromaticum: BN424_2540Help
Entry
BN424_2540        CDS       T02342                                 

Gene name
map2
Definition
glycosyl hydrolase family 65, N-terminal domain protein (EC:2.4.1.8)
Orthology
K00691  
maltose phosphorylase [EC:2.4.1.8]
Organism
cml  Carnobacterium maltaromaticum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cml00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2535364..2537634)
Genome map
AA seq 756 aa AA seqDB search
MIQRLFDIDSWKVATTKLDKEHKRLQESLTAIGNGYMGMRGNFEEGYSGDSHVGTYLAGV
WYPDKTRVGWWKNGYPDYFGKVINATNFIGVDIFVNQHKVDTFVDEIKDFHLELDLQTGI
LHRHYTWVSGEIEIKFSFKRFVSVAQKELCIVEVAAEVLKGEASIQFNAKLDGNVTNEDS
NYDEKFWLEMDRGLGEYSYLTTKTIPNDFEIPQFTVTIMMKNRVSDEKKGHTTDQEMLVQ
EQFDYQLKAGEKAKLTKLIAVVTSRDIEPNQQVAKAEELLRVAEDAGISKLEREHKIVWG
KRWHKADVVIAGDPESQQGIRFNIFQLFSTYYGEDARLNVGPKGFTGEKYGGATYWDTEA
YIVPMYLSVTEPEVSQQLLKYRHDQLPGALHNARQQGLKGALYPMVTFTGVECHNEWEIT
FEEIHRNAAIAYAIYNYTNYTGDEAYLLSDGIDVLTEISRFWADRVHYSKRNEAYMLHGV
TGPNEYENNVNNNWYTNTMATWVLRYTLESLKKVSKEKLVDLQITETEKDQWQDIIAKMY
YPKNQELGIFVQHDTFLDKDLRAVETLAATERPLNQHWSWDKILRSCFIKQADVLQGLYF
LNNEYTIEEKKKNFEFYEPMTVHESSLSACIHAILAAEVGLEDKAVELYARTARLDLDNY
NNDTEDGLHITSMSGSWLAIVQGFAGMRTYENQLQFKPFCPKGWDGYEFKISYRGRLLKI
IVTKTTASVILVEGEALDLTLCGENVRVTDQVQQAI
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgattcagcgattatttgatattgattcttggaaagtagcaacaactaagttagataag
gaacataagcgtctgcaagaaagcttaaccgcaattggcaatggttatatggggatgcgc
ggtaattttgaagaaggatactctggtgattcacatgtgggaacgtatttagcaggtgtt
tggtatccggataaaacgcgtgttggttggtggaaaaatggttatccagattattttgga
aaagtcattaatgcaactaattttatcggggttgatattttcgttaatcaacataaagtc
gatacctttgttgatgaaattaaggatttccatttagagttagatttacaaacaggaatt
ttacatcgccactatacatgggtctctggagaaatagaaattaaatttagctttaagcgc
ttcgtaagtgttgcccaaaaagaactttgcatcgttgaagttgctgcagaagttttaaaa
ggagaagcctcaattcaatttaatgctaaattagatggaaatgtaaccaatgaagatagt
aattatgatgagaaattttggttggaaatggatcgtgggctaggagaatatagctattta
acaacgaagactattcctaatgattttgaaatcccgcagtttactgtcacaataatgatg
aaaaatagagtgtcagatgagaagaagggtcacactacagatcaagaaatgctagttcaa
gagcagtttgactaccaacttaaagctggagaaaaagctaagttaaccaagttaattgcc
gttgtgacaagtcgtgatatcgaaccaaatcagcaagttgctaaggcagaagagctatta
cgtgtagctgaagatgctggaatcagcaaattggaacgtgaacataaaatcgtttggggc
aaacgttggcataaagctgatgtagtgattgccggtgaccctgaatcacaacaaggcatt
cgttttaatattttccaattgttttcgacttactatggagaagatgctcgcttaaatgtt
ggaccaaaaggttttactggtgaaaaatatggtggtgcaacttactgggatacagaggcg
tatattgttccaatgtatttatctgttacagaaccagaagtatcgcaacaactattaaaa
taccgtcatgaccaattaccaggggcactgcataatgctagacaacaaggattaaaaggt
gcactttatccaatggtaacgtttactggtgtagagtgtcataatgagtgggaaattact
tttgaagaaatacaccggaatgcagcaattgcctatgctatttataattataccaattac
acaggcgacgaagcttatctactttctgatggaatcgatgttttaactgaaatctcaaga
ttttgggcagatcgtgtgcattattctaaacgaaatgaagcatacatgctacacggtgta
actggtccaaatgaatatgaaaataatgtgaataacaactggtatacaaatacgatggca
acttgggtactacgttatactttagagtcattaaaaaaagttagcaaagaaaaattagtt
gatttacaaattacagaaactgaaaaagatcaatggcaagatatcattgctaagatgtat
tatccaaaaaatcaagaactaggaatttttgtacagcacgatacattcttagacaaagat
ttaagagcagtcgaaacgttagcagcaacagaacgtcctttaaatcaacattggtcatgg
gacaaaattttacgctcatgctttattaagcaagcagacgttctgcaaggtctctatttc
ctaaataatgaatatactatagaagagaaaaagaaaaatttcgaattttatgagccaatg
actgttcacgaatcgtcattatctgcttgtattcatgctattttagcagcagaagttgga
ttagaagataaagcagttgaattatatgctcggacagcacggttagatttagataattac
aacaacgatactgaggatgggctgcatattacctcaatgagtggaagttggttagcgatt
gtccaaggctttgctggaatgcgaacttatgagaatcaattgcagtttaaacctttctgt
ccaaaaggctgggatggctatgaatttaaaattagctaccgtggacgtttattaaaaata
attgtaacaaagactacggcatcagttatcttagttgaaggcgaagcacttgatttaact
ttatgcggtgaaaacgttcgtgttacagaccaagttcaacaagcgatttaa

DBGET integrated database retrieval system