KEGG   Carnobacterium maltaromaticum: BN424_298Help
Entry
BN424_298         CDS       T02342                                 

Definition
lin2722 protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(337691..338569)
Genome map
AA seq 292 aa AA seqDB search
MKKWVPLLCLVFLAIIGSFYLAQSKKESSIEQSKKDLKNQIPIILLHGSGGDEYSFSPFS
EELIQKEDSSSEVLPVTINEDGLLDYQGSLNSDTNRPLISLGFTENNAPIEDWSAWLKIL
MIDLKKHYGFQQADIIGYSNGGLAATYYAETIGHDSNVPTLRRLVLIGAPFNDLDEEENA
GNANFEELVGQSPELGNYLAIKQHLSKDLAVLSIAGDDETETYTDGIVPLRSALSSRFIF
PEYVHTYFEKITTEGPSDHLSLLSNQQVIDWTYWFLFDYKLAKEREIIFASQ
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtgggttccattactatgtttagtttttttagccattatcggctctttctat
ctagcccaatcaaaaaaagaaagctcaattgagcaatcaaaaaaggatttaaaaaatcaa
attccaattattttattacatggcagtggcggcgatgaatactctttctcgcctttttca
gaggaactcattcaaaaagaagatagctcttcagaggtcttaccggtgacaattaatgaa
gacgggctcttagactatcaaggatcattaaattcagatacaaatcgtcccttaatttca
ctaggcttcacagaaaataacgcaccgattgaagactggagcgcttggttaaaaatttta
atgattgatttaaaaaaacactatggctttcaacaagcagatattatcggctattcaaat
ggcggtctagcagcaacctattatgcagaaactattggtcacgatagcaacgtgccaact
ttacgccgcttagttttaatcggagcaccttttaatgatttggatgaagaagaaaatgct
ggtaacgctaattttgaagaactcgtaggccaatcacctgaattgggaaactatctagct
attaaacaacatctttcaaaagatttagctgttttatccattgctggtgacgatgaaact
gaaacctatacggatggaattgtacctttacgaagtgcgctctcatcacgttttattttc
cctgaatatgtccatacatattttgaaaaaataacaacagaagggcccagtgaccatctt
agcttattaagtaatcagcaggtcattgattggacgtattggttcctatttgattataaa
cttgctaaagaacgggaaattatatttgctagtcaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system