KEGG   Carnobacterium maltaromaticum: BN424_3015Help
Entry
BN424_3015        CDS       T02342                                 

Gene name
npr
Definition
NADH peroxidase (EC:1.11.1.1)
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3008551..3009909)
Genome map
AA seq 452 aa AA seqDB search
MKVIIVGASHGGHQSALEILDRYEGADVTIYEKGDFVSFLSCGMQLYLEDKVTQVDDVRN
FKPEDIEKRGGKVKSQHEVLTFDADKKEVTIKNLATGELLVDTYDKLILASGVTPAALPV
PNADLENIFFMRGRAWALQIKDKLSDDKVKNVVVIGSGYIGVEAAEVFAKAGKNVTIIDM
IDNVLGNYLDQEMTDILAPVFKENGVNLELGAQIKGFVGEKQVTGVEHQNGVVDADLVIV
AAGVTPNTSWLEGLVDLEERGQIKVDEYLRTSAKDVYAVGDAILPLNVASQKHAPVALAT
TARREARYVVRNLTKDQPTEKFQGVLGTSALAVFGYNLAMTGLNEFSASRSEVQIKGNFY
KDTLRPTFVKNDGNTEVYVKLNFDEKSHKILGGQVLSTYDITAHINTLALAIKTGLTLED
LAEADFFFQPGFDRQWSLLNLAAQSALGETKF
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaataattgtaggagcaagtcacggtggacatcaatcggcgttagaaatttta
gacagatatgaaggtgccgatgtaacgatttatgagaaaggcgattttgtctcattttta
tcatgcggaatgcagttgtatctggaagataaggttactcaagttgatgatgtacgaaat
ttcaagcctgaagatattgaaaaacgtggtgggaaagttaagagtcagcacgaagtttta
acttttgatgcagacaaaaaagaagtgaccattaaaaatttagcaacaggtgaactgttg
gttgacacatatgacaaacttattttagcttctggagttactccggcagcattaccagtt
ccaaatgctgatttagagaatattttctttatgcgtggtcgtgcttgggctcttcaaatc
aaagacaagctttctgatgataaagttaaaaatgttgtcgtgattggtagcggctatatt
ggtgttgaggcggcagaagtttttgctaaagctggcaaaaatgtcacaatcattgatatg
attgataatgtcctaggaaactatttagatcaagagatgacagatattttagcaccagtt
tttaaagaaaatggtgtgaaccttgaacttggggcacaaataaaaggctttgttggtgaa
aaacaagttacaggtgttgaacatcaaaatggtgttgtggatgctgatttagtcattgta
gcggctggggtaacaccaaatactagctggcttgaaggtttagttgatttagaagagcgt
ggacaaattaaagttgatgagtatttacgtacatcggccaaagatgtttatgctgttgga
gacgcaatcttgccattaaatgtagcaagccaaaaacacgcgcctgtagcattggcgaca
acggctcgtcgtgaagctagatatgtcgttcgtaatctaacaaaagatcaacctactgaa
aaattccaaggtgtacttggaacaagtgctttagctgtatttggatacaatttagctatg
actggtttaaatgaattttcagctagtcgctcagaagtacaaatcaaagggaacttttac
aaagatacgttgcgcccaacatttgttaaaaatgatgggaatactgaagtttatgtgaaa
cttaattttgatgaaaaatcccataaaatacttggtggacaagtcttatcaacatatgat
attactgcccacatcaatacacttgcgcttgccattaaaacgggcttaacattagaagat
ttagctgaagctgacttcttcttccaaccaggttttgaccgtcaatggagtttgttaaat
ttagcagctcaatcggctttaggcgaaactaaattttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system