KEGG   Carnobacterium maltaromaticum: BN424_3165Help
Entry
BN424_3165        CDS       T02342                                 

Definition
mga helix-turn-helix domain protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3189916..3191412)
Genome map
AA seq 498 aa AA seqDB search
MSYEIGKGLSRQYLLLRQLHNSSVPLTKNDLSKELNCSRPTLNNTLILADNLIDRYGSIE
KSSDGIILKEKKSINDAFIKAIILKETVLYQFVYSFLFEKIVSIESWAFDHFMSTSYVYS
KMKSIRAFLRENKLELVTGGEFITIEGSEHQIRFLFFQLFKHTSLIDEEWLFSKYNVKAI
AQLSQDLAKELGIYFSPVCEYQFCIAVAINLQRSCNDYHGEPSERQWESWKYYQTQFNFN
NAFSNFERKIGKKIEEAERINILYSIIQLPFRYSSYENAMSRIKNIKALVPESYQLAKEL
FALFHENPKTNYFGFAYLLDMFAVFSAIELYQDISVVKLFSDEENEQLFANKELVKQVED
LISEYEEKSDFYFLKVNRQYLLKSIFQMNQFSERLRGISKVIRVTIISEKGYSQELKQGA
KFLQQFTQNRIELINSLEVYFDEAHLNVDLILSDYYPVNISSNLPIFLWNSEPTEKDFRM
LKKQIELLLEGKPDLANE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
ttgtcttatgaaattggtaaagggttaagtcgacagtatttgttattgagacaattgcac
aattcgtcagtgccgttaactaaaaatgacttatcaaaggaattaaactgttccagacca
actttaaataacaccttgatattggcagataatctgattgacagatacggatcaattgaa
aagagtagtgatggaattatattaaaagaaaaaaaaagcattaatgacgcttttataaaa
gctataatcttgaaagaaactgttttataccaatttgtctattcctttctatttgaaaaa
attgtatccattgaaagttgggcttttgaccattttatgagtacttcctatgtttatagt
aaaatgaaaagtatacgcgcttttttaagagaaaataaattggaattagtaactggtggg
gagtttattactattgaaggttctgaacaccaaatccgttttttattcttccaattattt
aaacacacgtcattgattgatgaagagtggcttttttcaaaatataatgtcaaggccatt
gcccagctaagtcaagatttagcaaaggaattaggtatttatttttcccccgtttgtgag
tatcaattttgtatagcagtggctattaatttacagcgctcttgcaatgattatcatggg
gaaccttctgagcgccaatgggaatcgtggaaatattatcaaactcaattcaattttaac
aatgcattttcaaattttgaaagaaagattggtaaaaaaattgaagaagcggaacggata
aatatactgtacagtattattcagttacctttccgttattcttcttatgaaaatgctatg
agccgcattaaaaatattaaggcattggttccagaaagttatcaacttgccaaagaactt
tttgctctattccatgaaaatcctaaaaccaattattttggatttgcctatttattggat
atgtttgccgtgttctcagctatcgagctttatcaagatatctctgttgttaagctattt
tctgatgaagaaaatgaacaattatttgcaaataaagaacttgtaaaacaggttgaagac
ttaattagtgaatatgaagaaaaatccgatttttattttttaaaggtaaatcgtcaatat
ttattaaaatccatttttcagatgaatcagttttcagaaagattacgtgggattagtaaa
gtgattcgagtaacgattatttctgaaaagggatatagccaagaattaaagcaaggtgct
aaatttttacaacaatttactcaaaataggattgagctgattaattctttagaagtttat
tttgatgaagcacatttgaatgtggacttgattctatctgattattatccagttaatata
agctctaatctgccaatttttttatggaatagtgagccaacggaaaaagatttcagaatg
ttaaaaaagcagattgaattattgcttgaaggtaaacctgatttggctaatgagtaa

DBGET integrated database retrieval system