KEGG   Carnobacterium maltaromaticum: BN424_3175Help
Entry
BN424_3175        CDS       T02342                                 

Gene name
katA
Definition
vegetative catalase (EC:1.11.1.6)
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
cml  Carnobacterium maltaromaticum
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cml00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BN424_3175 (katA)
  Amino acid metabolism
   00380 Tryptophan metabolism
    BN424_3175 (katA)
Enzymes [BR:cml01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     BN424_3175 (katA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3202454..3203911)
Genome map
AA seq 485 aa AA seqDB search
MTKNLDSHKSNLTTDAGAPIGDNQNSMTAGNRGPVLIQDVALLEKLAHFNRERIPERVVH
AKGAGAHGYFEVTNDLTEYTKADFLSEIGKKTPVFTRFSTVAGESGSADTLRDPRGFAVK
LYTDEGNYDIVGNNTPIFFIRDAIKFPDFIHTQKRDPQTHLKNHNAIWDFWSLSPESLHQ
VTILMSDRGIPATFRHMHGFGSHTFKWTNAAGESVWVKYHFKTEQGIKNLTAEVAEELAG
SNPDYHTEDLFNAIENGDAPAWKLCVQIMPLADADHYRFNPFDVTKVWSQKDYPLIEVGR
MVLDRNTDNYFAEVEQVTFTPGNIVPGVDFSPDKLLQGRLFAYGDAHRHRVGANSHLLPI
NRPKNEVKNYHRDGAMRSDANGGSSVYYEPNSLGGPTETLANKQASFEVHGMADSVAYDD
DDHYTQAGDLYRLLSEDGKTRLIANIVGHMQPVEDEAIKVRQIQHFLKADPEYGTRVAAG
LGINI
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaaaaatctagacagccacaaatcgaatttaactactgatgcaggcgcaccaatt
ggggataaccaaaactcaatgacagctggtaatcgtggtccagttttaatccaagatgtt
gcacttttagaaaagttggcgcattttaaccgtgagcgtattccagagcgtgtggtacat
gcaaaaggtgccggtgcccatggatattttgaagtgacgaatgatttaacggaatataca
aaagctgatttcttatctgaaatcgggaaaaaaacacctgtattcacacgtttttcaacg
gttgcaggtgaaagtggttctgcagatacattgcgtgatcctcgtggctttgcagtaaaa
ttatatactgatgaaggaaattatgatattgtcggaaataatacgccgattttctttatt
cgcgatgcaatcaaatttccagattttatccatacacaaaaacgtgatcctcaaacacat
ttgaaaaatcataatgctatttgggatttctggtcattgtcaccagaatctttacaccaa
gtgacgattttaatgtcagatcgcggaattcctgcgacgttccgtcatatgcatggtttt
ggaagtcatacctttaaatggaccaatgctgctggcgaaagtgtttgggttaaatatcat
tttaaaacagagcaaggaattaaaaatttaacagctgaagtggctgaagagttggctgga
agtaatcctgattaccatacagaagatttatttaatgccattgaaaatggagacgcacca
gcttggaaattgtgtgtccaaattatgcctttagccgatgcagatcattatcgttttaat
ccatttgatgtaaccaaagtttggtcacaaaaagactatccattaattgaagttggtcgt
atggtcttagatcgcaatacagataattactttgcagaggtagaacaagtaacctttacg
ccaggcaatattgtaccaggagttgatttttcaccagataaattgttgcaaggtcgttta
tttgcttatggtgatgctcatcgtcatcgtgttggggcaaatagccacttattgccaatt
aatcgcccgaaaaatgaagttaaaaactaccatcgtgatggagcaatgcgttcagatgcg
aatggtggaagttccgtttattacgagcctaatagcttaggtggaccaactgaaacgcta
gcaaataaacaagctagttttgaagttcatggaatggcggattcagtagcgtatgacgat
gatgaccattatactcaagctggtgatttatatcgtctactatctgaagatggtaaaaca
cgcttgattgcgaatattgtaggacacatgcagccagttgaagatgaagcgattaaagtt
cgtcaaattcaacatttcttaaaagctgacccagagtatggaacgcgtgttgcagctggt
ttagggattaacatttaa

DBGET integrated database retrieval system