KEGG   Carnobacterium maltaromaticum: BN424_3179Help
Entry
BN424_3179        CDS       T02342                                 

Gene name
thiL
Definition
(GenBank) acetyl-CoA acetyltransferases family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cml  Carnobacterium maltaromaticum
Pathway
cml00071  Fatty acid degradation
cml00072  Synthesis and degradation of ketone bodies
cml00280  Valine, leucine and isoleucine degradation
cml00310  Lysine degradation
cml00362  Benzoate degradation
cml00380  Tryptophan metabolism
cml00620  Pyruvate metabolism
cml00630  Glyoxylate and dicarboxylate metabolism
cml00640  Propanoate metabolism
cml00650  Butanoate metabolism
cml00900  Terpenoid backbone biosynthesis
cml01100  Metabolic pathways
cml01110  Biosynthesis of secondary metabolites
cml01120  Microbial metabolism in diverse environments
cml01130  Biosynthesis of antibiotics
cml01200  Carbon metabolism
cml01212  Fatty acid metabolism
cml02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cml00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN424_3179 (thiL)
   00630 Glyoxylate and dicarboxylate metabolism
    BN424_3179 (thiL)
   00640 Propanoate metabolism
    BN424_3179 (thiL)
   00650 Butanoate metabolism
    BN424_3179 (thiL)
  Lipid metabolism
   00071 Fatty acid degradation
    BN424_3179 (thiL)
   00072 Synthesis and degradation of ketone bodies
    BN424_3179 (thiL)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN424_3179 (thiL)
   00310 Lysine degradation
    BN424_3179 (thiL)
   00380 Tryptophan metabolism
    BN424_3179 (thiL)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN424_3179 (thiL)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN424_3179 (thiL)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN424_3179 (thiL)
Enzymes [BR:cml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN424_3179 (thiL)
Exosome [BR:cml04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN424_3179 (thiL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CCO12600
UniProt: K8E6T6
Position
complement(3206870..3208039)
Genome map
AA seq 389 aa AA seqDB search
MREIVIIDAVRTPIGKYRGSLKDSSAVDLGVTVVKGALERANIDPESVDQVIFGNVLQAG
LGQNVARQISIKAGIPYQAVAMTINEVCGSGLKAIMLGRQAIQLGEADVVVVGGTENMSQ
APSLVASTAVGMELKSEELINSMFHDGLTDAFGEYPMGVTAENVAEKFKVSREEQDLFAY
QSHMKAAAAQEKGLFKSEIVPVQLADGTWFTEDETIRGNSTVEKLATLKTVFKENGTVTA
GNSSGINDGASALILMSKERAIAEGIPYLATIKATSEVGIAPEIMGYAPYYAVKKVLEKG
DYTIDQIDLFQLNEAFASQSIAVARDLEVPAEKLNIYGGAIALGHPIGASGARVVTSLLQ
ELQQTNTKVGIASLCIGGGLGVAMVVERD
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaatagttattatagatgcagtgcgaacaccgattgggaaataccgtggtagt
ttgaaagatagctcagcagttgatttaggcgtaacagtagtaaagggtgcgttagaacgt
gctaatatcgatccagagagtgttgatcaagttatctttggaaatgttttgcaagctggt
ttaggtcaaaatgtagctcgtcagatatcaattaaagcaggaattccttatcaagctgtt
gctatgacgattaatgaagtttgtggttctggtttaaaagcaattatgttaggtagacaa
gctattcaactgggtgaagcagatgttgtcgttgttggtgggactgaaaacatgtcacag
gccccttctttggttgccagtacagcggtcggaatggagttaaaatcagaagaattaatc
aatagcatgtttcatgatggcttaacagacgcttttggggaatatccaatgggcgtgaca
gctgaaaatgttgctgagaaatttaaagttagtcgagaagagcaagatttgtttgcgtat
cagtcccatatgaaggctgccgcagctcaagaaaaagggttatttaagtctgaaattgtt
cctgttcaattagctgacggaacttggtttactgaagatgaaacgattcgtggcaattca
acagttgaaaaattagcaactttaaaaacggtttttaaagaaaatggaaccgtgactgct
ggtaactcatcaggcattaacgacggcgcatcagccttgattttaatgtctaaggaacga
gcaattgcagaaggaattccttatttagcaacaataaaagcaacttctgaagttgggatt
gctcctgaaattatgggttatgcaccttattatgctgtaaaaaaagtcttagaaaaaggc
gattatacgattgatcaaattgatttattccaattaaacgaggcctttgcttctcagtcg
attgctgttgctcgtgacttagaagtaccagcggaaaagttaaacatttatggtggagca
attgcattaggtcatccaatcggtgcatcaggcgcacgagttgtgaccagtttgcttcaa
gaattacaacaaaccaatactaaagttgggatagcttccttatgtatcggtggtggacta
ggtgtggcaatggttgttgagcgagattaa

DBGET integrated database retrieval system