KEGG   Carnobacterium maltaromaticum: BN424_3214Help
Entry
BN424_3214        CDS       T02342                                 

Definition
deoxyribodipyrimidine photolyase
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3250794..3251093)
Genome map
AA seq 99 aa AA seqDB search
MSVIGMWFRKDLRLTDNTALIAALKEAQLKNDKLVGIFHLNPLQFKVTSFNHDYFFTAVA
HFVEVAKAAGLPIHFLYGEIEAAFEELTQKNSDFKPDLL
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgataggaatgtggtttcgtaaagatttaaggttaacagacaatacagcacta
attgcagcactgaaagaggctcaattaaaaaatgacaaactagttgggattttccatcta
aatccgcttcaatttaaagtaacgagttttaatcatgattatttttttactgcggtcgcg
cattttgttgaagtagctaaagcagctggcttgccaattcattttttatatggagagata
gaagcagcttttgaggaactaactcaaaaaaattccgactttaaaccagatttactttaa

DBGET integrated database retrieval system