KEGG   Carnobacterium maltaromaticum: BN424_3464Help
Entry
BN424_3464        CDS       T02342                                 

Gene name
rplA
Definition
(RefSeq) ribosomal protein L1
  KO
K02863  
large subunit ribosomal protein L1
Organism
cml  Carnobacterium maltaromaticum
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:cml00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    BN424_3464 (rplA)
Ribosome [BR:cml03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    BN424_3464 (rplA)
  Bacteria
    BN424_3464 (rplA)
  Archaea
    BN424_3464 (rplA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3449511..3450200)
Genome map
AA seq 229 aa AA seqDB search
MAKKSKQYQTAAKQVDVTKAYSVEEAVALVKSIDFAKFDATVEVAYRLGVDPKKADQQIR
GAVVLPNGTGKTQRVLVFAKGDKAKEAEAAGADYVGESDLVQKISGGWFDFDVIVATPDM
MAEVGRLGRVLGPKGLMPNPKTGTVTMDVTKAINEIKAGKVTYRVDKAGNVQAPIGKVSF
DDAKLVENFKTINDTMLKVKPSSAKGQYIKNITVTTTFGPGVKVDQGSF
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaaaagcaaacaatatcaaactgctgcgaagcaagttgatgttacaaaagct
tattcagtagaagaagcagttgctttagtaaaatcaattgattttgctaaatttgatgca
acagtagaagtcgcttatagacttggtgttgaccctaagaaagctgaccaacaaattcgt
ggtgcagttgttcttccaaacggaacaggtaaaactcaacgtgtattagtattcgctaaa
ggcgataaagctaaagaagcagaagctgcaggcgcagattacgtaggtgaatctgatctt
gtacaaaaaatcagtggtggatggttcgatttcgacgttatcgttgctacacctgacatg
atggcagaagttggtcgtcttggacgtgtgttaggacctaaaggtttaatgcctaaccct
aaaactggtactgtaactatggatgttactaaagctattaacgaaatcaaagcaggtaaa
gtaacttaccgcgttgataaagctggtaacgtacaagctccaatcggtaaagtatcattt
gatgatgctaaattagtagaaaactttaaaacaatcaacgatacaatgttgaaagttaaa
ccgtcttctgctaaaggacaatacatcaaaaatattacagttacaacaacttttggtcct
ggcgtaaaagttgaccaaggttcattttaa

DBGET integrated database retrieval system