KEGG   Carnobacterium maltaromaticum: BN424_3464Help
Entry
BN424_3464        CDS       T02342                                 

Gene name
rplA
Definition
ribosomal protein L1
Orthology
K02863  
large subunit ribosomal protein L1
Organism
cml  Carnobacterium maltaromaticum
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:cml00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    BN424_3464 (rplA)
Ribosome [BR:cml03011]
 Ribosomal Proteins
  Mitochondria
   Large subunit
    BN424_3464 (rplA)
  Bacteria
    BN424_3464 (rplA)
  Archaea
    BN424_3464 (rplA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3449511..3450200)
Genome map
AA seq 229 aa AA seqDB search
MAKKSKQYQTAAKQVDVTKAYSVEEAVALVKSIDFAKFDATVEVAYRLGVDPKKADQQIR
GAVVLPNGTGKTQRVLVFAKGDKAKEAEAAGADYVGESDLVQKISGGWFDFDVIVATPDM
MAEVGRLGRVLGPKGLMPNPKTGTVTMDVTKAINEIKAGKVTYRVDKAGNVQAPIGKVSF
DDAKLVENFKTINDTMLKVKPSSAKGQYIKNITVTTTFGPGVKVDQGSF
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaaaagcaaacaatatcaaactgctgcgaagcaagttgatgttacaaaagct
tattcagtagaagaagcagttgctttagtaaaatcaattgattttgctaaatttgatgca
acagtagaagtcgcttatagacttggtgttgaccctaagaaagctgaccaacaaattcgt
ggtgcagttgttcttccaaacggaacaggtaaaactcaacgtgtattagtattcgctaaa
ggcgataaagctaaagaagcagaagctgcaggcgcagattacgtaggtgaatctgatctt
gtacaaaaaatcagtggtggatggttcgatttcgacgttatcgttgctacacctgacatg
atggcagaagttggtcgtcttggacgtgtgttaggacctaaaggtttaatgcctaaccct
aaaactggtactgtaactatggatgttactaaagctattaacgaaatcaaagcaggtaaa
gtaacttaccgcgttgataaagctggtaacgtacaagctccaatcggtaaagtatcattt
gatgatgctaaattagtagaaaactttaaaacaatcaacgatacaatgttgaaagttaaa
ccgtcttctgctaaaggacaatacatcaaaaatattacagttacaacaacttttggtcct
ggcgtaaaagttgaccaaggttcattttaa

DBGET integrated database retrieval system