KEGG   Carnobacterium maltaromaticum: BN424_407Help
Entry
BN424_407         CDS       T02342                                 

Gene name
zurA2
Definition
ABC transporter family protein (EC:3.6.3.-)
Orthology
K09817  
zinc transport system ATP-binding protein [EC:3.6.3.-]
Organism
cml  Carnobacterium maltaromaticum
Pathway
ABC transporters
Module
Zinc transport system
Brite
KEGG Orthology (KO) [BR:cml00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BN424_407 (zurA2)
Enzymes [BR:cml01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     BN424_407 (zurA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
448097..448804
Genome map
AA seq 235 aa AA seqDB search
MHYIEVKDLTFYYEQEPVLENISFHVDPGEFVMLTGENGAAKSTLLRNVLGLLKPAKGTA
TISPVNVNGEKLSIGYIPQQIASFNAGFPSTVLELVRSGRYQQGRWFKRLTPEDHEHVRR
ALLSVGMWEMRDRKVGELSGGQKQRICLARIFATDPDLFVLDEPTTGMDIEARADFYKLL
RHNSEVHGKGILMVTHDHDDIKDYADRHIQLVRKEDSPWRCFAMNSCNMPSKPHS
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
gtgcattatatagaagtaaaagacttaactttttattatgaacaagagcccgtgctagaa
aatatttcttttcatgtagatcctggtgaatttgtgatgttaacgggtgaaaatggagcg
gcaaaatcaaccttattacgaaatgttttaggtttattaaagccagctaagggaacagct
acgatttctccagttaatgtgaatggagaaaaattaagtattggttatattccccaacaa
atagcctcttttaatgcaggttttccaagtactgttttggaattggttcgttcaggacgt
taccaacaaggccgctggtttaaacgcctaacccctgaggatcatgaacatgtgcgacga
gctttgttatcagtaggtatgtgggaaatgcgtgatagaaaagtgggagaattatctggt
ggtcaaaagcaacgtatttgtttagcgcgcatttttgcgacagatcctgatttatttgta
ctagatgaaccaacaacaggaatggatattgaagccagagcagatttttacaaattattg
cgtcataatagtgaagttcatggaaaaggaattctgatggtaacccatgaccacgacgat
attaaagactatgctgatcgtcatattcagttagtgcgaaaggaggattcgccatggaga
tgtttcgccatgaattcatgcaacatgccttccaagcctcattcttaa

DBGET integrated database retrieval system