KEGG   Carnobacterium maltaromaticum: BN424_49Help
Entry
BN424_49          CDS       T02342                                 

Definition
mga helix-turn-helix domain protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
55584..57050
Genome map
AA seq 488 aa AA seqDB search
MRIEDFLEKKEGLQIAILKKLVLENGKISYEDLRNYLGISKASLESYLEELESYLSEYQG
DCRVKSDGSKIELFVSNHFSIVTVYTDYVKRSLKFQLIDYAFKHQKFTAVKITNDLSISE
SSLFRKIKESNDLLKEFNIQIKNGSLHGEELQIRYFYFQLYWLVTPNEKFQETVLPAQIH
NLINGFEKELDIKISDFSRIRVHLWFAISKKRANISEKIYKNSQKKLKLYENDRLYKQVR
QLILLYFSRYSIEVGEEESMLHFIFLTTQSILSEKDFINYDLIRSRRTPTALVDTLLRET
VLHYYLPVKPSLALERKISYYLSQINGTLYFFEGALEIYDREDFLAQESKVWRKNLKNLS
EELLTTALANFNQKATSLNTLQGLTLLEYSSVLSIVDFKISKELHIGIDLNLMEMHTEIL
TQMLELNLKNVTGITVEEYKKQRNYDLVITNNLAFSEYPKGTEIYVTSDFFSSYDLKQIK
SRINELKI
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaggattgaggattttttagaaaaaaaagaaggattacaaattgctattttgaaaaaa
ttagttctggagaatggcaagatttcttatgaggatctacgtaactatttaggaatttcg
aaagcatcattagagagttatttggaagaattagagtcgtatttgtctgaatatcaaggc
gattgtcgtgtgaaatcagatggttctaaaattgaactatttgtgagcaatcatttttct
atcgtgacggtttatactgattatgtaaaacgatcacttaaattccaattaatagattat
gcttttaaacatcaaaaatttacggctgttaaaattaccaatgatttatcgattagtgaa
tcttctttgtttcgaaaaataaaagagagcaatgacctacttaaagaattcaatattcaa
atcaagaatggaagccttcatggagaggaattgcaaatacgttatttttatttccagctg
tattggctcgtgacacctaatgaaaaatttcaagaaacggtattacctgcccaaatccat
aatttaatcaatggctttgaaaaagaattagacataaaaattagtgattttagccgaatt
agagttcatttgtggtttgcaattagtaaaaaacgagcgaatatatctgaaaaaatctat
aaaaatagtcagaaaaaattaaagctttatgaaaatgatcggctttataagcaagtaaga
cagttgattttactttactttagtcgttattctattgaagtgggagaagaagagagcatg
ctccattttatctttttaacaacccaatcaattttatctgagaaggattttattaattat
gatttaattcggagtcgtcgaactccgacggctttagtcgatacacttttgagagaaacg
gtgctccactactatttacccgttaagcctagtctcgcattggaaagaaaaattagttat
tatctctcgcaaattaatggtactttgtatttttttgagggagcacttgaaatttatgac
cgagaagattttttggcgcaagaaagtaaagtttggagaaaaaatttaaaaaacctgtcg
gaagagttattaacgacagctttggctaatttcaatcagaaagccaccagtttgaataca
ctacagggattgacgttactagaatactccagtgtgctatcaattgtggattttaagatc
tcaaaagaattgcatattggcattgatttaaatttaatggagatgcacacggagatttta
acacagatgctagaattgaatttaaaaaatgtaacggggattacggtagaagaatataaa
aaacaacgtaattatgatttagtaattacaaataatttagctttttcggagtatccgaaa
gggacagaaatttatgtcacctcggacttcttttctagttatgatttgaagcaaatcaag
tctcgaattaatgagttgaaaatctga

DBGET integrated database retrieval system