KEGG   Carnobacterium maltaromaticum: BN424_551Help
Entry
BN424_551         CDS       T02342                                 

Definition
ubiE/COQ5 methyltransferase family protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
603060..603653
Genome map
AA seq 197 aa AA seqDB search
MDAKEIKRRWNNFANEYAATHGEYGDIHKEIVLNPAIFSLIGMIENKEVLDAGCGEGYLS
RLLAKEKARVTGVDYSTRMIEIAEERTNSNLAIKYFEGNCEKLDFLADESFDLVISNMVI
QDLPEYESALKEMYRILKPNGELVFSILHPCFVTPNSGWEKDVNGDKLFWRVDNYFYEGE
YRQKLGKEADILFFTEL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggatgctaaagaaattaaacgtagatggaataattttgcaaacgaatatgcagcaacg
catggcgagtatggggacattcacaaagaaatagtattaaacccagctattttttcacta
attggaatgattgaaaataaagaagtgttagatgcaggctgtggagaaggttatttaagc
cgccttttagctaaagagaaagccagagtcacaggagtagattattcaacaagaatgatt
gaaatagctgaagaacgaacaaattcaaatctagcaattaaatattttgaaggtaactgt
gagaagctagattttttagcagatgaaagctttgatttagttatttcaaatatggttatt
caggatttaccagaatacgagtctgccttgaaagaaatgtatcgtatactaaaaccaaat
ggtgagttagttttttctattttacacccttgttttgtgacgcctaatagtggctgggag
aaggatgtaaatggagataaacttttttggagggttgataattatttttatgaaggtgaa
tatcgacaaaaattaggaaaagaagcagatattctttttttcacagaactttaa

DBGET integrated database retrieval system