KEGG   Carnobacterium maltaromaticum: BN424_739Help
Entry
BN424_739         CDS       T02342                                 

Gene name
tnp
Definition
transposase, Mutator family protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
796865..798037
Genome map
AA seq 390 aa AA seqDB search
MTQVHFTLNSEEVQRIIEYSVKDEVSKNILTTVFNQLMENQRTEYIQAEDYERSENRQSQ
RNGYYERNYTTRVGTLELKVPRTRDGKFSPTIFERYQRNEKALLASMIEMYVSGVSTRKV
SKIVEELCGKSVSKSFVSSLTEQLDPMVNEWQNRLLSEKNYPYLMTDVLYIKVREENRVL
SKSCHIAIGISKDGDREILGFMIQNEESEDTWSYFFEHLKNRGLRGTELVISDAHKGLVS
AVRQSFLNASWQRCQVHFLRNILTSIPKKNSKPFREAVKAIFKFTDINLARVAKNRLVSD
YIDQVKYSKACETLDNGFEDAFQYTLFGNAHNRLKSTNLLERLNQEVRRREKIIRIFPNC
VSANRLIGAVLIDQHDEWLSSSRKYIKFAK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagtacattttacactgaatagcgaagaggttcaaaggattattgaatattcc
gtaaaagatgaggtgtctaaaaatattttgacaacggttttcaatcaattaatggagaat
caaagaaccgaatacattcaagccgaagactatgaacggtctgaaaatagacaaagtcaa
cgaaatggatactacgagaggaactatacaacacgtgttggtacacttgaattaaaagta
cctagaacacgtgatggcaagttttctcctacgatatttgaacgatatcagagaaatgaa
aaagccttgcttgcttcaatgattgagatgtatgtctccggtgtttctacacgaaaagtt
tcaaaaattgttgaagaactgtgtgggaaatcggtgtctaaatcctttgtttctagtctg
actgaacagttagaccctatggtcaatgagtggcagaatcgcttgctctcagagaaaaat
tatccatacttgatgacagatgttctttatataaaagtacgagaagagaatcgagttctt
tctaaaagctgccatatcgctattggaataagcaaagacggggatcgtgagatcctcgga
ttcatgattcaaaatgaagaaagtgaggatacctggtcctacttctttgaacacctaaaa
aacagaggattacgaggaactgaacttgtgatttccgatgctcataaaggcttagtttct
gcggttcgtcagtcgtttctcaatgcaagttggcagagatgtcaagttcactttttaaga
aacatccttacgagtattcctaaaaagaattcaaaaccttttagagaggccgtaaaagca
atctttaaatttacagatatcaacctagcacgggtagctaaaaatcgcctggtcagtgac
tatattgaccaggtaaaatattcaaaagcttgcgaaaccctggacaatggcttcgaagat
gcttttcaatataccttatttgggaatgcccacaatcgtttaaaaagtaccaaccttctt
gagcgattgaaccaagaagtgcgcagaagagaaaaaattattcgtatctttccaaactgc
gtttcagccaatcgtttaatcggagcagtccttattgatcaacacgatgagtggctttct
tcatcaagaaaatatattaaatttgccaagtaa

DBGET integrated database retrieval system