KEGG   Carnobacterium maltaromaticum: BN424_806Help
Entry
BN424_806         CDS       T02342                                 

Gene name
vanZ
Definition
vanZ like family protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
865751..866401
Genome map
AA seq 216 aa AA seqDB search
MFFLQNLYEFTESNFGDTINHFPLIKLIFYSVDRTLRYFLVWLLIRGIYLLYKHLKGTKI
RVAREFVVQFFVFYVILLFQLTVFRGEYSITNVYIELRPLSEVNWQPFTETFKLTQGTSL
FDFYYNLYGNIFWFIPLGFCVAYLSQNNHPFLRTFFIGLFCSIAIETMQFLFRTGIADVD
DVMFNTTGALIGFVLYEVYFLLKKLFSKQKRRKEAV
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgttttttttacaaaatttatatgagtttacagagtcaaattttggggacactattaat
cactttcctttaattaaacttattttctatagtgttgatcgtacacttcgttatttttta
gtctggcttttaattagaggtatttacctactatacaaacatctgaagggaactaaaatc
agagttgcaagagaatttgttgttcagtttttcgtgttctatgtaattttgttatttcaa
ctaactgtgtttcgtggggaatatagtattacaaatgtctatattgaactacgcccctta
agtgaagtgaattggcaaccatttaccgaaacatttaaactaacacaaggaacatctttg
tttgatttttactataatttatatggaaatatcttttggtttattccgttaggtttctgt
gtggcttatctttcacaaaataatcatccgtttttacgcacattttttatcggtttattt
tgttcaattgctattgaaacaatgcagttcttatttaggacaggtatcgcagatgtagat
gatgtaatgttcaataccacaggagcgctaatcggttttgtattatatgaagtttatttc
ttgctaaaaaaattattttccaaacaaaaaagacgaaaagaggcagtctga

DBGET integrated database retrieval system