KEGG   Carnobacterium maltaromaticum: BN424_824Help
Entry
BN424_824         CDS       T02342                                 

Gene name
yuaG
Definition
(GenBank) SPFH domain / Band 7 family protein
  KO
K07192  flotillin
Organism
cml  Carnobacterium maltaromaticum
Brite
Membrane trafficking [BR:cml04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Flotillin-dependent endocytosis
    BN424_824 (yuaG)
Chromosome and associated proteins [BR:cml03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    BN424_824 (yuaG)
Exosome [BR:cml04147]
 Exosomal proteins
  Proteins found in most exosomes
   BN424_824 (yuaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Band_7 Flot TrbI
Motif
Other DBs
NCBI-ProteinID: CCO10288
UniProt: K8EER5
Position
884768..886216
Genome map
AA seq 482 aa AA seqDB search
MVIGLCVFVVLMCLVIFISKYQTANPDEALIISGSYLGVKNVFKDDSGNKIKIVRGGGAF
VLPVFQRSNRLSLLSSKLDVSTPEVYTEQGVPVMADGTSIIKIGSSVEEIATAAEQFLSK
TRDELENEAREVLEGHLRSILGSMTVEEIYQNRDKFSQSVQEVASVDLAKMGLIIVSFTI
KEVKDKNGYLDSLGKPRIAQVKRDADIAIAEADKETRIKRAEAEKNSKKSELERETEVAE
ALKEKELKLAAYKQEQDIAKAQADQAYGLESAKAQQKVTEEEMTVKIIERQKQIELEEKE
ITRREKQYDSEVKKKADADRYAKEQEALANKAREVAEAEADQFRVEAMATANANQVRLEG
QAIADAILAKGQADAEAKAKIAEAFKQYGEAAILSMVVEMLPNMVKEAAQPMGNIEKITV
IDNGQGEGSGSGANRVANYATNLLATSQETLKETTGLDVKDLIEKFVTKAPQTIHQDIHQ
DK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
ttggtaattggtttgtgtgtttttgttgtattaatgtgtttagtaatttttatttcaaag
tatcaaacagctaatcctgatgaagctttaattatcagtggaagttatttaggtgtaaaa
aatgtatttaaagatgattctggtaataaaattaaaattgttcgtggtgggggagccttt
gtgttacctgttttccaacgttctaatcgtttaagtttattatcaagcaagttagatgta
tcaacaccagaagtttatacagagcaaggtgttccggttatggctgatggaacatccatt
attaaaattggctcttctgttgaagaaattgcaacagcagctgaacaatttttaagtaaa
accagagacgaattagaaaatgaagctcgtgaggttttagaaggtcatctgcggtcaatc
ttaggctcaatgacagttgaagaaatctatcaaaatcgagataaatttagccaaagtgtt
caagaagttgccagtgttgatttggcaaaaatgggtttaattattgtttcctttacaatt
aaagaagtaaaagataaaaatggctacttagattcattaggtaaacctcggattgctcaa
gtgaagcgtgatgctgatattgcaattgctgaagcagacaaagaaactagaattaaacgt
gccgaagctgaaaagaactcgaaaaaatcagaattagaacgtgaaacagaagtagcagag
gccttaaaagaaaaagaattgaaactagcagcttacaagcaagagcaagatattgcgaag
gcccaagcagatcaagcttacggtttagaaagtgctaaagctcaacaaaaagttacagaa
gaagaaatgacggttaaaattattgagcgtcaaaaacaaattgaattagaagaaaaagaa
attacgcgtcgtgagaaacaatacgattcagaagtgaagaaaaaagccgatgctgatcgt
tatgcgaaagaacaggaagccttagctaacaaagctagagaagttgctgaagctgaagcg
gatcaattccgggttgaagctatggcaacagccaatgctaaccaagttcgtttagaagga
caagcaatcgctgatgctattttagcaaaaggacaggcagatgctgaggcaaaagccaag
attgctgaagcctttaaacaatatggtgaagcagctattctatctatggtagttgaaatg
ttaccaaatatggtaaaagaagcggctcaaccaatggggaatattgaaaaaattacagtt
attgataatggtcaaggtgaaggtagtggaagtggcgcaaatcgagtcgccaattatgca
acgaatttattagcgacttcacaagaaactttaaaagaaacaactggcttagatgttaaa
gatttgattgaaaaatttgtaacaaaagcgcctcaaacgattcatcaagacattcaccaa
gataaataa

DBGET integrated database retrieval system