KEGG   Carnobacterium maltaromaticum: BN424_825Help
Entry
BN424_825         CDS       T02342                                 

Definition
hypothetical protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(886225..886836)
Genome map
AA seq 203 aa AA seqDB search
MELGQFRLGMRTVKTGIAVAICILIFHYSGRGTPMIASLSAVFALREDVETTVKFGKSRI
LGNSIGALIAALFIFIQGQLGSSFLIELIGIPFCIMFIIIICDGINYNSGIIGAIATLLI
IYFSIPNNETFIYALERVGDTFIGTFIAITINHLIRTPAHEEVKEIKADLKTLDEEKAEL
EELLNDTKPKNSKKNNLKLILEL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggaacttggacaatttagacttggtatgagaacagtaaaaacaggaattgcagttgca
atttgtattctaatcttccattatagtggacgtggaactccgatgattgcttctttatct
gccgttttcgccttaagagaagatgttgaaacaactgttaagtttggaaaatctaggatt
ttgggcaactcaatcggagctttaattgctgccttatttatttttattcaaggacaacta
ggctcttctttcctaattgaattaattggtatccctttttgtattatgttcattattatc
atttgtgatggtattaattacaactctggaattattggagcgattgcgactttattaatt
atttatttttcaattcctaataatgaaacttttatttatgcattagaacgtgttggagat
acatttattggcacctttatcgctattaccattaaccatttaattcgaactcctgctcat
gaagaggtcaaagagattaaagcagatttgaaaactttagatgaagagaaagcagagctt
gaagaacttttaaacgatacaaaacctaaaaacagcaaaaaaaataacctaaaactcatt
ttagagctttag

DBGET integrated database retrieval system