KEGG   Carnobacterium maltaromaticum: BN424_826Help
Entry
BN424_826         CDS       T02342                                 

Definition
(GenBank) putative lipoprotein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YkyA
Motif
Other DBs
NCBI-ProteinID: CCO10290
UniProt: K8E2P0
Position
complement(886857..887522)
Genome map
AA seq 221 aa AA seqDB search
MNFKLLNKKVYFVLLPLLFLVLASCGNTEERAGAKKIAEENNERIENINTHLEKYEALEE
DMMTALSNDLKDKNAEKIIRKKTGEVGENFKARKKELASIQKNMTKLKENQDTLLDYQAK
KAVDMPETELENAIQTLKQLSITYDLFYSYYEKTVDAESEFYQNFSSDMKKEELAEAISL
INISHGAAFQQLEVLSADLSSTAFAMTNLADAIKEKDKKTQ
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
ttgaattttaagttactaaacaaaaaagtctatttcgttttattgccgctattgttctta
gtattagctagttgtggtaacactgaggaacgcgctggagctaaaaaaattgccgaagaa
aataatgagagaattgaaaatatcaatactcatttagaaaaatatgaagctttagaagaa
gatatgatgacagctttaagtaacgatttaaaagataaaaatgctgaaaaaatcattaga
aagaaaacaggtgaagttggcgaaaactttaaagctcgtaaaaaagaacttgcaagtatt
caaaaaaatatgactaaacttaaagaaaatcaagatactttacttgattatcaagcaaaa
aaagcagtcgatatgcctgaaactgaattagaaaatgcgattcaaactcttaaacaactt
agtatcacctatgatttattttatagctattatgaaaaaacagtggatgccgaatctgaa
ttttatcaaaatttttcttctgatatgaagaaagaggaattagcagaagcaattagtttg
attaatatcagtcatggtgccgcttttcaacaattggaagttctaagtgctgatctcagc
tcaactgccttcgcaatgacaaatttagctgatgcaattaaggaaaaagataaaaaaact
caataa

DBGET integrated database retrieval system