KEGG   Carnobacterium maltaromaticum: BN424_827Help
Entry
BN424_827         CDS       T02342                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArAE_1 ArAE_1_C FUSC_2 DUF2955
Motif
Other DBs
NCBI-ProteinID: CCO10291
UniProt: K8EP71
Position
887711..888685
Genome map
AA seq 324 aa AA seqDB search
MRIGLRTIKTAVGAAIAIFIAEKFQLNYAVSAGIITILSVQNTKKKSITLAGQRILSTLL
ALGISSIFFNLVGFNPLAFGLYLVVFIPLAVRLSLTDGIVVSSVLVTHFLIEESTSVDWW
TNSFGLMLIGLSIAILANLYMPSSEGRLQELQMECENQMKLILLDFSGTLRNGHFHSEEN
PLLIKLNQLLNEAVNLAKNQHNNQFFGQSYYYIKYFDMRQMQTYVLHQIKEDLSQCHLPT
MENEKLAEMLIRTAEGLHENNSADQLMADIQKLFEHFRNSPLPETRAEFENRAMLFKMLN
DFMHFIEIKQVFYKEFASEKKISV
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagaattggtttaaggaccattaaaacggcagttggagcagcaattgcgatttttatt
gctgagaaatttcagttgaattatgctgtatcagcaggaattatcactattttaagtgtc
caaaatacgaaaaaaaaatcaattacattagctgggcaaaggattctatcaaccttacta
gccttgggaatttcttcgattttctttaatttagtcggctttaatccactcgcatttggt
ttatatttagttgtatttatcccgttagctgtgcgtttaagtttaaccgatggaattgtt
gttagttctgttttagttactcattttttaatcgaagaaagcacctcagtagactggtgg
accaattcttttggtttaatgctcattggtttaagtattgcgattttagctaatttatat
atgccatctagtgaaggcagattgcaggagttacaaatggaatgtgaaaatcaaatgaaa
ctaattttattagacttttcaggcacattacgaaatggccattttcacagtgaagaaaat
ccgcttttaattaaactaaatcaacttttaaatgaagctgtgaatctagctaagaatcaa
cataataatcaattttttggacaaagttattactatataaaatattttgatatgcggcaa
atgcaaacctatgtcttgcatcaaatcaaagaagatctaagtcagtgtcatttacctaca
atggaaaatgaaaaattagctgagatgttgattcgaacagcggaagggttacatgaaaat
aattctgctgatcagttaatggcagatattcaaaagctttttgaacattttagaaatagt
ccattacctgaaacacgggctgaatttgaaaatcgagcgatgttatttaaaatgttaaat
gattttatgcattttattgaaatcaaacaagttttctataaagaatttgcttcagaaaag
aaaataagtgtctag

DBGET integrated database retrieval system