KEGG   Carnobacterium maltaromaticum: BN424_833Help
Entry
BN424_833         CDS       T02342                                 

Gene name
acuB
Definition
(GenBank) CBS domain pair family protein
  KO
K04767  
acetoin utilization protein AcuB
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
893450..894097
Genome map
AA seq 215 aa AA seqDB search
MYVKNYMTAEVITISEETKILEALDLMKDHQIHRLPVTKDGQIKGLVTEGIIQENSPSTA
TSLSIHEMNYLLTKTAVGDIMLKNVITIAPDALLEEAADTMRKNQVSVLPVIGTDHKLVG
IITEKDIFAAFLDLLGYYNQGTRVVVDIKDDHTGILEKLTHLFTEEQMNIDQIAVYRQSG
LTQVVIQVASVEVAKIKQKLMDNGYTVSSCSLKEG
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtaaaaaattatatgactgctgaagtcatcacaatttccgaagaaactaaaatt
ttagaagctttagatttgatgaaagatcatcaaattcatcgattaccagtcacaaaagat
ggacaaattaaaggcctagtcacagaagggattattcaagaaaattccccttcaacagct
actagtttaagtatccatgaaatgaattatctattaactaagacagccgtcggagatatc
atgttaaagaatgtgattacaattgcccctgatgcattgttagaagaagctgcagataca
atgcgcaaaaatcaagtgagcgttcttccagttattggaacagatcataaattagtcgga
attataacagaaaaagatatttttgctgcctttttagatttattaggttactataaccaa
ggaacgcgggttgttgttgacattaaggatgatcatacagggattttagaaaaactaaca
catctgtttacagaagagcaaatgaatatcgatcaaattgctgtttatcgtcaatctggt
ctaactcaggttgtgattcaagttgcaagtgttgaagttgctaaaataaaacaaaaatta
atggataatggatatacagttagttcatgtagtttaaaagaaggataa

DBGET integrated database retrieval system