KEGG   Carnobacterium maltaromaticum: BN424_836Help
Entry
BN424_836         CDS       T02342                                 

Definition
(GenBank) glyoxalase/Bleomycin resistance/Dioxygenase superfamily protein
  KO
K04750  PhnB protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase 3-dmu-9_3-mt Glyoxalase_2
Motif
Other DBs
NCBI-ProteinID: CCO10300
UniProt: K8E2P5
Position
895202..895645
Genome map
AA seq 147 aa AA seqDB search
MTVQLTTFLSMNGRAKEAISFYQEYLEAKVLFIKNYVELKEMDPTFEFIEAEANYIAHSV
LEIGGGMLMVADEIMSANKKEIIGTNFSLCITGEVEEIKKMYAKLNTHPNVKIVIPLEPN
IFGNAYGIVEDPFGITIQLVNEKQAKK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgacagtacaattaacaacatttctttcaatgaatgggagagcaaaagaagcaatttca
ttttatcaagaatatttagaggctaaggttttatttataaaaaattatgtagaattaaaa
gagatggatccgacttttgaatttattgaagcagaagcgaactatattgctcactctgtt
ttagaaataggcggagggatgttaatggtggccgatgaaattatgagtgccaataaaaaa
gagattatcgggactaatttctcactttgcattactggagaagtggaagaaatcaagaaa
atgtatgcaaaattaaatactcatcctaatgttaagatagtgattcctttggaacctaat
atttttggtaatgcatatggaattgttgaagatccttttggtataacgatccaactggtt
aatgaaaaacaagccaaaaagtaa

DBGET integrated database retrieval system