KEGG   Carnobacterium maltaromaticum: BN424_839Help
Entry
BN424_839         CDS       T02342                                 

Definition
(GenBank) putative uncharacterized protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
898070..898609
Genome map
AA seq 179 aa AA seqDB search
MNQALVKIVLMAIKEQFISEKAFYKDQLGITPQSWDRWKKGEQGLKAENMQKIALLFTDY
EWMLVQKVCRNALILPEVAENPVSEFQHMKFYVAKKWVNSGIADLDFKRNDSKEETENSY
RKPAVTTLRVSVNYEFWSYKDSIELRLPGIIQQQIEREKQDLLEWFNENIGEKFPPMTK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagccttggtaaaaatcgttttaatggcaattaaagaacaatttattagtgag
aaagcattttataaagaccaactggggattactccacaaagttgggatcgttggaaaaaa
ggtgaacaaggattaaaagctgaaaacatgcagaaaatagcgttattatttactgattat
gaatggatgcttgtacaaaaagtttgccgaaatgcacttattttaccggaagtcgctgaa
aatccagtctcagaatttcaacacatgaaattttatgtagcaaaaaaatgggtgaatagt
ggtatagcagatttagattttaaacgaaatgattcaaaagaagaaacagaaaatagctac
cgtaaaccagcagtaacaacattacgggtctcggttaattatgaattttggagttataaa
gatagcattgagttacgtttaccaggtattattcaacaacaaattgagcgagaaaaacaa
gacttgttggaatggtttaatgaaaatataggtgaaaaatttccgccaatgactaaataa

DBGET integrated database retrieval system